SecReT6
Protein ID: 386864299
SecReT6 ID646
T6SS typei3
Gene symboltssJ-4
Locus tagBP1026B_II0585
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]726037..726618 [+]
Producttype VI secretion system
NoteTssJ
UniProt IDI1WRF5
KEGG IDbpz:BP1026B_II0585
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-12, Aligned region: 15..150
Protein Sequence: 193 a.a.     [Download]
>gi|386864299|ref|YP_006277247.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADWLPTQ
GGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEGRGLI
HMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKTTYGTRRSRQ
 
Nucleotide Sequence: 582 bp     [Download]
>gi|386863735|ref|NC_017832.1|:726037-726618 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCTCGGCCTTCTCGT
CGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCTGAACGTCGCGCC
GACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGGCTGCCGACGCAG
GGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACTCGCGGCACGTGA
TCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTGGCTCGTCGCCGA
CGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGCCGCGGCTTGATT
CACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCGTGCCCGTCGGCG
GCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAAAACCACCTATGG
GACAAGGAGAAGCAGGCAATGA