SecReT6
Protein ID: 386864300
SecReT6 ID646
T6SS typei3
Gene symboltssK-4
Locus tagBP1026B_II0587
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]726615..727976 [+]
Producttype VI secretion system
NoteTssK
UniProt IDI1WRF6
KEGG IDbpz:BP1026B_II0587
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|386864300|ref|YP_006277248.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|386863735|ref|NC_017832.1|:726615-727976 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAGTAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCTCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGACCAGGACGGCCTGGGGCTCGGCCGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCGGACGATCCGCTGCCGCCGCCGCTGGAAACCGAGCTCG
CGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAGGCCGCGCGCACGGGCGGCCCGGAGATGGCGTTCGG
CGACGTCGAGCTGGCGTCGCGCTATCGCGCGGTGTCGACCGAGGTGCCGGATCTCGCGGTCGGGCTCGAC
GCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACGGGCCAGCTCGTCACGCGCCTGTGCTGGAAGTCGC
AGCTGCGCTCGGACGAGGTCGCGCTGCCGATCGCGCGCGTGGCGGGGCGCAACGCGAGCCGCACGGTGTC
GCTGGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTGGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGGG
GCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCTTGGCGAACCT
CGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAGCTGGTCGGCCTGCTCGGGCGGCTGAGC
GTGCTGCCGGGCGTCGACGAGGAGCTGGCCGACCGCGAGCTCGGCTACGACCACGACGATCTGCAGACGA
GCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACGCCGGTGTTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGGCTGAACGCGCTGCCCAA
TCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCCGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA