SecReT6
Protein ID: 386864301
SecReT6 ID646
T6SS typei3
Gene symboltssL-4
Locus tagBP1026B_II0588
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]728002..729717 [+]
Producttype VI secretion system
NoteTssL
UniProt IDI1WRF7
KEGG IDbpz:BP1026B_II0588
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-43, Aligned region: 141..336
OmpA [PF00691], Evalue: 5.10E-10, Aligned region: 395..502
Protein Sequence: 571 a.a.     [Download]
>gi|386864301|ref|YP_006277249.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSLLRNLSSTLRRVSMASNMLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPS
FAPPAADAFPQADGAPRNPAVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSH
ALPAVLQLQRHLAAGPLNQAAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHA
QVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDL
RSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAW
MPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPW
PGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPID
TAKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMP
ATRPTTEGRQP
 
Nucleotide Sequence: 1716 bp     [Download]
>gi|386863735|ref|NC_017832.1|:728002-729717 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAGCCTGCTACGAAACCTCTCCTCCACGCTGCGCCGCGTATCGATGGCATCCAACATGCTCGATCGCG
CGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCGCGGCGATGACGAG
CTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGCGGGCGCGCCGAGC
TTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCCGCGGTGCTGCAAT
TCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCAGCGCCCGTCGTCTACAGCGCGCA
GGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCCGTTCGTGTCGCAC
GCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAGGCCGCGATCCGCA
CGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCGAATGGGAGCAGAT
CCGCGACGCGTCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGCGCGCGAGCACGCG
CAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGGGGCGGCGAGGACG
CGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGTCGTTCTACGAACT
GATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGGCGACGTGCTGCTGCAGGATCTG
CGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACCGAGCTCGTCGCGC
CCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCGGCGTGCTGGTGCT
CGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGCGCTCGCCGCGTGG
ATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAGATTCTCACCGAAG
GGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACGGCGCGTTCGACGT
CGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGCGTTCGCGCCGTGG
CCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAGTTCCCGGACAACC
AGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGCTGCCGGGCGGCGC
GCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGCGCAGCCGATCGAC
ACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAGGTGATTCCCGACG
GCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGGTGCCGATGCGTCC
GGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTCAACCACGATGCCA
GCAACGCGACCGACCACGGAGGGCCGTCAGCCATGA