SecReT6
Protein ID: 386865274
SecReT6 ID647
T6SS typei1
Gene symboltssA-5
Locus tagBP1026B_II1586
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2005585..2007483 [-]
Producttype VI secretion system
NoteTssA
UniProt IDI1WU80
KEGG IDbpz:BP1026B_II1586
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 592..602
Protein Sequence: 632 a.a.     [Download]
>gi|386865274|ref|YP_006278222.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MGMSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEV
ADEADVAEATEATEATEATEAADVAETAETAETAETAETAETAEADAHGSTGGPAAEIAIAAAEQALIDP
AGRAAPSAGTDTNANADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRVACWSS
VCALPETDAENGRTRIAAPSASIVGAAKSIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGD
GADARREVETAVRALLTRLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPRPSPPE
RSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARD
HWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRL
ST
 
Nucleotide Sequence: 1899 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2007483-2005585 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGGGATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCGAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCCGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGTGGCTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGGCTGATG
TGGCTGAGACGGCTGAGACGGCTGAGACGGCTGAGACGGCCGAGACGGCCGAGACGGCCGAGGCCGATGC
GCACGGCTCGACGGGAGGGCCGGCTGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTGATTGATCCG
GCCGGTCGAGCCGCGCCGAGCGCAGGCACGGATACGAACGCGAACGCAGACGCCGCCGGGCAACCGGCGC
GGCTCGACGAAGCGGCCGGCCGCGAACGCGCGCTCGCCGATGCGCTCGCGCAACTGCATTGCGTCGCGAC
GGCGTTCGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGC
GTGTGCGCGCTGCCGGAAACGGACGCGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCG
TCGGCGCGGCGAAGAGCATCGACGGGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGC
GCAGGCGTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGGGGCGAC
GGCGCCGATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCACTGCTTACGCGGCTGCCGGGCCTCGACG
CGCTGACGTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGC
GCCTGTTGTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAG
CGATCGTCGCCGATGGCGGGCGAACCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCGCCGACGATG
CAGTGGACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGC
GATCGATCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCACGCGTGCGGTTGTGCGAGCTTGCGCGCGAC
CATTGGCCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGATTTGC
TCGCATGGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCG
CGAATCGGCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTG
TCGACGTGA