SecReT6
Protein ID: 386865278
SecReT6 ID647
T6SS typei1
Gene symboltssC-5
Locus tagBP1026B_II1588
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2010815..2012314 [+]
Producttype VI secretion system
NoteTssC
UniProt IDI1WU84
KEGG IDbpz:BP1026B_II1588
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-187, Aligned region: 72..497
Protein Sequence: 499 a.a.     [Download]
>gi|386865278|ref|YP_006278226.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQA
TIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPD
ITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSF
GKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFL
WGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQG
FIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSW
KERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTL
SLVGKLEKR
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2010815-2012314 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGCCGGACGCGACGCCGCCCGAGTCCCCCG
CCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCGCGACGAAGACGCATACCCGATCACGCG
CCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAGCGCCCGATCGAGACCGTGAGCCAGGCG
ACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCCGGCAGATCGACGCGATCCTCCATGACC
CGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTTTCTCGTCGATCGAACGGATTTCCGCGA
GAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTGTTCGACGACTTCGAGGATTCGCCCGAC
ATCACGAAATCCGGGCTGTACCAGAAGGTTTATACGGCCGAGTACGGCCAATTCGGCGGCCAGCCGATCG
GCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGACGTCAAGCTGCTGCAGTACGTCGCGAG
CACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGCCCCGCGTTCTTCGGCATCGATTCGTTC
GGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGGGGCCGCAATACGCGAAATGGAATGCGT
TTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCTTGCTGCGGCTGCCTTACGG
CGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGCGTCGACGGCGGCGACGCGCATTTTCTG
TGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGAGCTTCGCAGACTATCGCTGGTGCGCGA
ACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCCGCTCTACGCGTACGAATCGATGGGCGA
GATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGCCGCGAGTTCGAGCTCGCCGAACAGGGC
TTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCTTTTTCTCCGCGAACTCCACGCAGAAGC
CGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCTCAACTACCGGCTCAGCACGCAACTGCC
GTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTGATCCAGCGGGAAAACATCGGCTCGTGG
AAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCCGCCAGTACGTCGTCGACATGGACAACC
CGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCAGATCGTCGTGTCGGACGTCGAGGGCGA
ACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTCAAGTACATGGGCGCGTTCTTCACGCTG
TCGCTCGTCGGCAAGCTCGAAAAGCGCTAG