SecReT6
Protein ID: 386865280
SecReT6 ID647
T6SS typei1
Gene symboltssE-5
Locus tagBP1026B_II1592
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2013036..2013497 [+]
Producttype VI secretion system
NoteTssE
UniProt IDI1WU86
KEGG IDbpz:BP1026B_II1592
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.70E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|386865280|ref|YP_006278228.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MADRESSRAGEPRTRERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2013036-2013497 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGCTGATCGCGAATCGTCGCGGGCCGGCGAGCCGCGCACGCGCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGGGAAGCGGGCGGCGAGCACGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACCTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA