SecReT6
Protein ID: 386865282
SecReT6 ID647
T6SS typei1
Gene symboltssG-5
Locus tagBP1026B_II1593
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2015264..2016286 [+]
Producttype VI secretion system
NoteTssG
UniProt IDI1WU88
KEGG IDbpz:BP1026B_II1593
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.90E-81, Aligned region: 11..311
Protein Sequence: 340 a.a.     [Download]
>gi|386865282|ref|YP_006278230.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVERIDKADDGG
YRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDE
HALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVPQWLPIP
DDQRTRVGTRAHRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAV
DVVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2015264-2016286 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCGCGTATTTCCAGGCGATCCGGCTGC
TGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCCCGACGCGCCGCTGCCGATCCACAC
GCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGCATCGACAAGGCCGACGACGGCGGC
TACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGCCGCTGCCGACGTTCTACACCGAGG
ACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTTTCTCGACGTGCTGCATCGCGCGCT
CTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTGCGGATCGTCGAGGAACGCGACGAG
CACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCGACGCGCGCATCGCGCGCGACGCGGGCCTGCACG
AGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCGCTCCGCGGCCGGTCTGCGCGCGCT
GCTCGCCGACGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGCGTGCCGCAATGGCTGCCGATTCCG
GACGACCAGCGCACCCGCGTCGGCACGCGCGCGCACCGGCTCGGCGCCGACGCGCGGGTCGGCGCGCGCA
TGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCCCGGCCCGCTGTTCCGCGCGCTGAT
GCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTGTATCTGACCCAACCGTTCGCCGTG
GACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCTGCGGCCGCCGCGCGTGGTCGCGCG
TCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGCGTCGCCCGAATTCCGTCTTCCGAC
TTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA