SecReT6
Protein ID: 386865283
SecReT6 ID647
T6SS typei1
Gene symbolclpV-5
Locus tagBP1026B_II1595
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2016273..2019356 [+]
Producttype VI secretion system
NoteTssH
UniProt IDI1WU89
KEGG IDbpz:BP1026B_II1595
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 226..245
AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 688..855
AAA [PF00004], Evalue: 6.50E-20, Aligned region: 227..336
AAA [PF00004], Evalue: 6.50E-20, Aligned region: 694..813
ClpB_D2-small [PF10431], Evalue: 5.40E-14, Aligned region: 860..932
AAA_5 [PF07728], Evalue: 8.00E-14, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 8.00E-14, Aligned region: 693..808
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 409..439
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 692..787
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 37..117
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 269..307
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 664..729
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 758..787
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 830..894
AAA_16 [PF13191], Evalue: 5.90E-09, Aligned region: 897..973
Zeta_toxin [PF06414], Evalue: 4.30E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 4.30E-06, Aligned region: 305..353
Zeta_toxin [PF06414], Evalue: 4.30E-06, Aligned region: 687..734
AAA_25 [PF13481], Evalue: 7.60E-06, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 7.60E-06, Aligned region: 461..510
AAA_25 [PF13481], Evalue: 7.60E-06, Aligned region: 689..714
Clp_N [PF02861], Evalue: 1.20E-05, Aligned region: 28..75
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 116..131
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 436..467
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 500..511
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 595..608
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 691..725
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 894..918
IstB_IS21 [PF01695], Evalue: 6.10E-05, Aligned region: 219..254
IstB_IS21 [PF01695], Evalue: 6.10E-05, Aligned region: 693..729
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 276..374
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 692..714
AAA_17 [PF13207], Evalue: 0.0002, Aligned region: 227..249
AAA_17 [PF13207], Evalue: 0.0002, Aligned region: 693..729
TIP49 [PF06068], Evalue: 0.00033, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.00033, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.00033, Aligned region: 693..728
Sigma54_activat [PF00158], Evalue: 0.00038, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.00038, Aligned region: 692..794
ResIII [PF04851], Evalue: 0.0004, Aligned region: 210..246
ResIII [PF04851], Evalue: 0.0004, Aligned region: 292..307
ResIII [PF04851], Evalue: 0.0004, Aligned region: 664..727
AAA_10 [PF12846], Evalue: 0.00089, Aligned region: 223..245
AAA_10 [PF12846], Evalue: 0.00089, Aligned region: 288..313
AAA_10 [PF12846], Evalue: 0.00089, Aligned region: 399..488
AAA_10 [PF12846], Evalue: 0.00089, Aligned region: 693..840
NACHT [PF05729], Evalue: 0.0012, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0012, Aligned region: 693..714
AAA_14 [PF13173], Evalue: 0.0045, Aligned region: 277..328
AAA_14 [PF13173], Evalue: 0.0045, Aligned region: 692..775
Torsin [PF06309], Evalue: 0.0049, Aligned region: 651..719
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 694..735
Protein Sequence: 1027 a.a.     [Download]
>gi|386865283|ref|YP_006278231.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRACGADAARLRRQ
ADAALDARPAGDGGRPAFAPSLLALLQDAWLIASLELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSL
RKDALVARFASGACARSIESRASGALDAAPGEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAIVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSEYKKYFEKDAA
LARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRDELAERCAPDTPRVADIDRELAALSARAGALRDAWAAQ
RDAAQALVDARRACRAAADATAATDAAGTTGTAHAGELADSADVSDIADVAKMADAADAAPADAETGSNA
RDADARMPAGTCARIAPNPDARAWPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIAD
VVADWTGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFLLAGPSG
TGKTETALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDE
VEKAHPDVLNLFYQVFDKGSLSDAEGKEVDFANTVIFLTSNLGADIIADIAARGARPDPDAMRAAVRPAL
SRHFKPALLARMTEIPYAPLAPDTLADIARLKLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGAR
NVDFILQRHVLPALAQHVLVCAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDARDRSEASDASDAIDAVD
AVDAVDAVDAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 3084 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2016273-2019356 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGAACGCGCTCGAAAGCG
CCGTCGGCGCGTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
CGAGCCGTCGGCCGACGTCGCGCTGTTGCTGCGCGCGTGCGGCGCGGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCCGCGCTCGACGCGCGCCCGGCGGGCGACGGCGGCCGCCCCGCGTTCGCGCCGTCGCTGCTCG
CGCTGTTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGACACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCCCGCGCGGCGCGGCAGCCGTCGCCCGGCGGCGACGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCGTGCGCGCGATCGATCGAATCGCGCGCGTCCG
GCGCGCTCGACGCCGCGCCGGGCGAGGCGAGCGACACGCGCGACGCATCGAGCGCGATCGCCCGCTACTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCGGGATCGATCCGGTCTTCGGTCGCGACGCGGAAATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTCGGCA
AGACGGCCATCGTCGAAGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTGCCGGCGACGCTGCGCGGCGC
GACGCTGCTCGGCCTCGACCTCGGCATGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATCCGCGCGTCGCAAACGCCCGTCGTGCTGTTCATCGACGAAGCGCACA
CGCTGATCGGCGCGGGCGGCGCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCAGCCACCACGTGGAGCGAATACAAGAAGTATTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGGACGTCGCGACGTCGGTGATGATCCTGCGCG
GGCTGAAGGAGCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTGGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGCCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACCGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACCAAGCCCGCCGCGCTGGAGGACGCGCAGCGCGCGATCCAGGCGC
TCGAGCGCGAGCGGCGCGCGCTGCGCGACGAATTGGCCGAGCGCTGCGCGCCGGATACGCCGCGCGTCGC
CGACATCGATCGCGAGCTCGCCGCGCTGTCCGCGCGCGCCGGCGCGCTGCGCGACGCGTGGGCGGCGCAG
CGCGACGCCGCGCAGGCGCTCGTCGACGCACGCCGCGCGTGCCGGGCGGCGGCGGATGCAACGGCTGCAA
CGGATGCGGCTGGAACGACCGGAACGGCCCATGCCGGCGAGCTCGCCGATAGTGCCGACGTTTCCGATAT
CGCCGATGTCGCCAAGATGGCCGATGCGGCCGACGCCGCCCCTGCCGATGCCGAAACCGGCTCGAACGCC
CGCGACGCCGACGCACGCATGCCCGCCGGGACGTGCGCGCGCATCGCCCCGAACCCTGATGCGCGGGCGT
GGCCCCCTCTGCGCGCGCCGCACGCCGACGCGCGCGAGCGCGCGGCTCGTGCGCTCGCCGAAGCGACGCG
CCGCTTCGAGCACGCGCAGCGCGACACGCCGCTCGTGCGAATCGACGTCGACCCGGACGCGATCGCCGAC
GTCGTGGCCGACTGGACCGGCATCGCGGCCGGCAAGCTGCGCCGCGATCGCGCGAACGTGATGCTGCGGC
TCGCCGATACGCTGCGCCGCCGCATCCGCGGCCAGGATCACGCGATCGAACAGATCTCCGAAGCCGTGAA
GGCGGGCGCGGCCGGCGTCCACGATCCGCGCCGCCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGC
ACCGGCAAGACCGAGACCGCGCTCGCGGTCGCCGATGCGCTGTTCGGCGACGAGCGCTCGATCGTCGTCG
TCAACATGAGCGAATTCCAGGAGCGGCACGACGTGAGCCGCCTGATCGGCTCGCCGCCGGGCTACGTCGG
CTACGGCGAGGGCGGGATGCTGACCGAGGCGGTGCGCCAGCGGCCCTATTCGGTCGTGCTGCTAGACGAA
GTCGAGAAGGCGCACCCCGACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGTTCGCTGTCCGACG
CCGAAGGCAAGGAGGTCGACTTCGCGAACACGGTGATCTTCCTCACGTCGAATCTCGGCGCGGACATCAT
CGCCGACATCGCCGCGCGCGGCGCGCGGCCCGATCCGGACGCGATGCGCGCGGCGGTGCGCCCGGCGCTG
TCGCGCCATTTCAAGCCGGCGCTGCTCGCGCGGATGACCGAGATTCCGTATGCGCCGCTCGCGCCCGATA
CGCTCGCCGACATCGCGCGGCTGAAGCTCGAGCGCATCGCGGCGCGCGTCGCCGCGCAGCACGCGACGCG
CATCGTCTACGACGACGCCGTCGTCGCGCACGTCGCCGCGCGCTGCACCGAAGTCGAATCGGGCGCGCGC
AACGTCGATTTCATCCTGCAGCGCCACGTGCTGCCCGCGCTCGCGCAGCACGTGCTCGTGTGCGCGGGCA
ACGCGGCGCCGATGCCTGCGATTCGCGTCGCCATCGACGCCGGCGGCCGCTTCGTCGTCTCGAACGACGC
GCCGGCCGACTCCGATGCACGGGACCGGAGCGAAGCGTCCGATGCGTCTGATGCGATCGATGCGGTCGAT
GCGGTCGATGCGGTCGATGCGGTCGATGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCA
ACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACG
CTGA