SecReT6
Protein ID: 386865289
SecReT6 ID647
T6SS typei1
Gene symboltssJ-5
Locus tagBP1026B_II1602
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2027525..2028133 [+]
Producttype VI secretion system
NoteTssJ
UniProt IDI1WU95
KEGG IDbpz:BP1026B_II1602
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.80E-22, Aligned region: 2..145
Protein Sequence: 202 a.a.     [Download]
>gi|386865289|ref|YP_006278237.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTT
RYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRL
GAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPSADANEGGSGKRDKRGNAAARAPRKQ
 
Nucleotide Sequence: 609 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2027525-2028133 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGCGATGGGACTACGCGCCCGACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACC
TGAACGCGCCGCACACGCTGTTGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGC
CGACGATCCGGACCGGCTGCGCATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACC
CGCTACGTCGTCGCGCCCGGCCAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCG
GCATCGTCGCCGGCTACTACGACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCAT
CGACAAGCGCGGCTGGTTCTCCTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTC
GGCGCGCAGAGCATCACCGACGCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGA
CGGCGCTCGACAGCGGCGCGAAGACCCTGGCGCTGCCGAGCGCCGACGCGAACGAGGGCGGCAGCGGCAA
GCGCGACAAACGCGGCAACGCCGCCGCCCGTGCGCCGCGCAAGCAATGA