SecReT6
Protein ID: 386865290
SecReT6 ID647
T6SS typei1
Gene symboltssK-5
Locus tagBP1026B_II1601
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2028166..2029563 [+]
Producttype VI secretion system
NoteTssK
UniProt IDI1WU96
KEGG IDbpz:BP1026B_II1601
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-98, Aligned region: 16..462
Protein Sequence: 465 a.a.     [Download]
>gi|386865290|ref|YP_006278238.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIRSARLLFADRS
YVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRYATLPSAEEVADL
HSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRC
IRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVG
ELSVFSERFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRS
AQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2028166-2029563 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCACC
AGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGGCCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCT
CGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAGATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCC
GCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGC
GCCCGACGCGTTGCCCGACGCCCCGACGCGCTACGCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTG
CATTCGGACCATCCGGGCGCGCCGGTGCGCACGCTCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGC
TCGACGCGCTCGCCGCGCACGAAACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCT
CGACGACGATTTCGCGCCGCCCTGCTACGCGCTGTCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGC
ATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCG
CCGAATTCGACGCGAGCTATGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCT
GTTCCATCTCGCCGAATGCGACGGGCAGCATCCATGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGC
GAGCTGAGCGTGTTCTCCGAGCGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGC
CGTACGACCACCGCGATCTGGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGA
AATCGCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCG
GCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCAGATCTATCTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCGCGCTCGGCGGCCGGATCGCGGCGACCGACGAAATGCCGCAGCTCAC
CGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGCCTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGC
GACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGT
CGCTGCGCTGGGCCGACGCGCCGGACGACCTGCACGCGGAACTCGTCGCGGTGAGGCACACGCAATGA