SecReT6
Protein ID: 387132026
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0483
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]517186..517644 [-]
Producthypothetical protein
NoteTssB
UniProt IDI1YRG1
KEGG IDpit:PIN17_0483
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 152 a.a.     [Download]
>gi|387132026|ref|YP_006297999.1| hypothetical protein PIN17_0483 [Prevotella intermedia 17]
MAIFDYGIGGNEVNVDANESIADIPSNRTLLVQKLTDEAPVSPETVYGLQTVEDVFEHFSPSVQLEMQND
SGEDVTETMHFKNLGDFDSEKLKENSAFLSKLDVEKEQNIKIARQLSSNKALLKALANPETRQAVIDLLQ
SSLDELNNLEAK
 
Nucleotide Sequence: 459 bp     [Download]
>gi|387131618|ref|NC_017860.1|:c517644-517186 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGGCCATTTTTGATTATGGAATTGGTGGTAATGAGGTAAATGTTGATGCTAACGAGTCGATTGCCGATA
TACCTTCCAACAGAACTTTATTAGTACAGAAACTTACTGATGAGGCACCAGTAAGTCCAGAAACAGTCTA
TGGTTTACAGACTGTTGAAGATGTTTTTGAACATTTCTCACCATCGGTTCAGCTTGAAATGCAAAACGAT
AGTGGGGAAGATGTAACCGAGACGATGCACTTTAAGAATCTTGGTGACTTTGACTCAGAGAAATTAAAGG
AGAACAGTGCTTTTCTTAGCAAACTCGATGTTGAGAAAGAACAGAACATTAAGATAGCTCGTCAGTTATC
TTCAAATAAGGCATTGTTGAAAGCTTTGGCTAATCCAGAAACACGTCAGGCTGTTATCGACCTCTTGCAG
TCTTCACTTGACGAACTCAACAACTTGGAAGCCAAATAA