SecReT6
Protein ID: 387132033
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0490
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]523948..525057 [-]
Productphage-like baseplate assembly protein
NoteVgrG
UniProt IDI1YRQ8, I1YRQ8
KEGG IDpit:PIN17_0490
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 2.20E-18, Aligned region: 115..200
Phage_GPD [PF05954], Evalue: 0.0063, Aligned region: 15..86
Protein Sequence: 369 a.a.     [Download]
>gi|387132033|ref|YP_006298006.1| phage-like baseplate assembly protein [Prevotella intermedia 17]
MYGRPARQHALPRIHTESELIKYMRRKQAADTAETHYVTAESHVPELRVGSVVRLYSSFLERVGQLTRES
LGDFIITEIVHEVGDGSYYRNRFKAIPSTVEALPSPRVPMPVAETQMATVTSNADPNGNGRVQVRMNWQQ
GGMHTGWVRVMTPDAGKSGDVSSNRGFVFIPEVGDQVLLGFRHGDPGRPYVMGSLFNGSTGGGGGQGNKC
KSLTTRSGSSLKLDDSDGSVTLHDKGGVSMNFDGAGNSTFNSNTSHTVNAGSNASTNVGEGASVLNMDSG
GCVELTSQSEVSIKVGSASISMNNSSITLSIGSSSITLTSENILSKGTTLSMESTTSTSISGGQNIDISA
TQNHIGGETKMDGGDVFVN
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|387131618|ref|NC_017860.1|:c525057-523948 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGTACGGCAGGCCTGCGCGCCAGCACGCGCTTCCCCGCATCCACACGGAGTCCGAACTCATTAAATACA
TGCGCCGCAAGCAGGCGGCCGATACCGCCGAGACCCACTACGTCACTGCCGAGAGCCATGTGCCCGAGCT
CCGTGTGGGTTCCGTCGTCCGCCTCTACAGCTCCTTCCTGGAGCGTGTCGGTCAGCTGACCAGGGAGAGC
TTAGGCGACTTCATCATCACCGAGATCGTCCACGAGGTGGGTGATGGCAGCTACTACCGCAACCGCTTCA
AGGCCATTCCCTCTACCGTTGAGGCCCTTCCGAGCCCCCGTGTCCCGATGCCCGTGGCTGAGACGCAGAT
GGCGACTGTCACCAGCAATGCCGACCCGAATGGCAACGGCCGCGTCCAGGTTCGCATGAACTGGCAGCAG
GGCGGCATGCACACAGGCTGGGTACGCGTGATGACGCCCGACGCGGGCAAGAGCGGCGACGTGAGCTCCA
ACCGCGGTTTTGTGTTTATCCCAGAGGTTGGCGACCAGGTGCTGCTGGGCTTCCGACACGGAGACCCTGG
GCGTCCCTATGTTATGGGCAGCCTGTTCAACGGTTCCACTGGTGGCGGTGGCGGTCAGGGCAACAAGTGC
AAGAGCCTGACCACACGCAGTGGCAGCTCCCTGAAGCTCGACGACTCAGACGGCAGTGTTACGCTGCATG
ACAAGGGCGGAGTGAGTATGAACTTCGATGGTGCAGGAAATTCTACTTTTAATTCAAATACTAGCCATAC
TGTAAATGCAGGAAGTAATGCCTCTACTAATGTTGGCGAAGGTGCAAGTGTGTTGAATATGGATAGTGGG
GGGTGTGTAGAACTTACTAGTCAGTCCGAAGTGAGTATAAAAGTAGGTAGTGCTTCTATTTCTATGAATA
ATTCCTCTATAACTTTAAGTATTGGATCAAGTAGTATTACATTGACATCAGAAAATATTTTATCAAAAGG
TACGACGTTATCAATGGAATCAACTACAAGTACAAGTATATCTGGAGGTCAAAATATAGATATTTCAGCT
ACACAGAATCATATTGGTGGAGAAACTAAGATGGATGGTGGTGATGTTTTTGTAAATTAG