SecReT6
Protein ID: 387132036
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0493
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]526012..526389 [-]
Producthypothetical protein
NoteHcp
UniProt IDI1YRZ3
KEGG IDpit:PIN17_0493
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|387132036|ref|YP_006298009.1| hypothetical protein PIN17_0493 [Prevotella intermedia 17]
MELGGKEYDVLYSNYEFSRSTDSKGKPSSSISGGRVSVTVESTDDTTAIEAMLNSQFKAVEGKIVYKKTE
EDAKMKEIAFKNAYIVHYKETLDVNNETPMTIAMTFSAENITVGNAELDNRWPRM
 
Nucleotide Sequence: 378 bp     [Download]
>gi|387131618|ref|NC_017860.1|:c526389-526012 Prevotella intermedia 17 chromosome chromosome I, complete sequence
TTGGAGTTGGGCGGCAAGGAGTACGACGTACTCTATTCCAACTATGAGTTCAGCCGCAGTACGGACAGCA
AGGGCAAGCCTTCCTCAAGCATCTCAGGCGGTCGCGTTAGCGTGACCGTTGAGTCTACCGACGACACCAC
CGCCATCGAGGCGATGCTCAACAGCCAGTTCAAGGCCGTTGAGGGCAAGATCGTCTACAAGAAGACCGAG
GAGGATGCGAAGATGAAGGAGATCGCCTTCAAGAACGCCTACATCGTGCATTACAAGGAGACGCTTGACG
TGAACAACGAGACTCCCATGACGATTGCGATGACTTTCTCTGCGGAGAACATCACCGTGGGCAACGCCGA
GCTTGACAACCGCTGGCCAAGAATGTAG