SecReT6
Protein ID: 387132038
SecReT6 ID652
T6SS type
Gene symbol-
Locus tagPIN17_0495
Strain
Replicon [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]527118..527447 [+]
Productputative lysozyme
NoteTssE
UniProt IDI1YRX7, I1YRX7
KEGG IDpit:PIN17_0495
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-11, Aligned region: 3..93
Protein Sequence: 109 a.a.     [Download]
>gi|387132038|ref|YP_006298011.1| putative lysozyme [Prevotella intermedia 17]
MMLIVSRYGEVEGKEDYGSVIWDLEFNQVLKNADWEEKVRQSLEATITKYESRLKDIHVRVELTEVEEDV
RNKFPNARQRVRVWVNGVMVRNDQQFNFNTHLYISPISQ
 
Nucleotide Sequence: 330 bp     [Download]
>gi|387131618|ref|NC_017860.1|:527118-527447 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGATGTTGATAGTTTCCCGATACGGTGAAGTAGAAGGAAAGGAAGACTATGGTTCCGTTATTTGGGATT
TAGAGTTTAATCAAGTCCTCAAGAATGCTGACTGGGAAGAGAAAGTCAGACAATCGCTCGAAGCTACAAT
AACGAAATATGAGTCTCGGCTTAAAGATATTCACGTCAGAGTAGAGCTTACAGAGGTTGAAGAGGACGTT
AGAAACAAGTTTCCTAATGCTCGTCAACGTGTCCGTGTATGGGTAAATGGCGTTATGGTCAGAAACGATC
AGCAATTCAACTTCAACACACATCTCTATATAAGTCCTATTTCTCAGTAA