SecReT6
Protein ID: 387132039
SecReT6 ID652
T6SS type
Gene symbol-
Locus tagPIN17_0496
Strain
Replicon [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]527460..529217 [+]
Producthypothetical protein
NoteTssF
UniProt IDI1YRB4, I1YRB4
KEGG IDpit:PIN17_0496
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 0.00036, Aligned region: 25..88
Protein Sequence: 585 a.a.     [Download]
>gi|387132039|ref|YP_006298012.1| hypothetical protein PIN17_0496 [Prevotella intermedia 17]
MIDKRQQIIKERIQKFAMDLWNIADPRQVDPVIDLILDVIAYNSSRLYQSIDNSDSSILQRLARLLVPHK
WSLPSPSHALMSVEPKDNDSCLLTPMDFFHTRKMIFDKGWVELDFSPLSNYPLFNAEIKAISFDRRIIYN
SKDGQQAGVFPDIDKKDEDNVVWVGFSMSESMLRSSQQLVLCILPEDGSLAPFLKDIQAYDGEGKALNVT
VPSFPLADSDKYQYFDNISAYYANNYIQIDLDTPTCSTFPQEWVCSDDTKEKDKLVWIKLKFPLAFHYVN
FEKVRLLLNTYPVVNRSLVTRRHNFAKQGNIVSLPCKGNRFLLNIESLQDDFNHKYMDVSKHYGENPVGT
YNLYFGNLERFDSDNARTLINKLLQLVREDGSAFKALDIDTLTAQLNELYHNIESIEKSVYESVQNKNNS
RAFLFTQPYKDINDAEVNYWVTDAEAANGLDSRASIYQYNNEKFSSSGLVFQTESKQGNSHSGDQELINS
LRYGLLTRERIVTREDVKSFLLCQLGQWIDSIKIEDGIAISQDVRRGIVRTTEVKICLSRGGKAENIDLP
AMTNFLEGELSKRSVSNTPYKIFFV
 
Nucleotide Sequence: 1758 bp     [Download]
>gi|387131618|ref|NC_017860.1|:527460-529217 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGATTGATAAAAGACAGCAAATCATTAAGGAACGTATTCAAAAATTTGCAATGGATTTGTGGAATATCG
CAGATCCAAGGCAGGTGGACCCTGTTATTGATTTGATTCTTGACGTAATAGCATACAATAGCAGTAGACT
TTATCAAAGCATTGACAATTCAGACTCAAGCATTTTGCAGCGTCTGGCGCGTTTGTTAGTGCCGCACAAA
TGGTCTCTTCCTTCACCTTCCCACGCTTTGATGAGCGTTGAGCCCAAAGATAATGATTCTTGTTTACTGA
CACCTATGGACTTCTTCCATACAAGGAAGATGATATTCGATAAAGGTTGGGTAGAATTAGATTTTTCTCC
TTTAAGCAATTACCCTTTGTTCAATGCAGAAATCAAAGCAATATCTTTTGACCGACGAATAATATACAAC
TCGAAAGATGGACAACAAGCGGGTGTTTTTCCTGATATAGACAAGAAGGACGAGGATAATGTAGTATGGG
TTGGATTTTCAATGTCAGAAAGCATGTTGCGTTCTTCACAGCAGCTTGTATTGTGTATTCTACCTGAAGA
TGGCAGTCTTGCTCCTTTCTTGAAAGATATACAGGCTTATGATGGAGAAGGCAAGGCTTTGAACGTTACT
GTTCCAAGTTTTCCACTTGCCGATAGTGATAAGTATCAATATTTTGACAATATCAGTGCTTACTACGCCA
ACAACTATATTCAGATAGACCTTGACACACCGACATGCAGCACATTTCCTCAAGAATGGGTTTGTTCTGA
TGATACAAAAGAAAAGGACAAGTTGGTATGGATAAAGCTGAAATTTCCTTTAGCATTCCATTATGTAAAC
TTTGAGAAGGTAAGACTTTTGCTCAACACCTATCCTGTAGTAAATCGTAGTTTAGTTACGAGAAGACATA
ATTTTGCTAAGCAAGGTAATATTGTTTCCCTTCCTTGTAAGGGTAACCGTTTCCTTTTGAATATTGAATC
ATTACAAGATGATTTCAACCATAAATATATGGACGTTTCCAAGCATTATGGTGAAAATCCAGTGGGTACA
TACAATCTCTATTTTGGAAATCTTGAAAGATTCGACTCCGATAATGCACGTACATTAATTAATAAACTTC
TCCAATTGGTTCGTGAAGATGGCAGTGCGTTTAAGGCCTTAGATATAGATACTCTAACAGCACAATTGAA
CGAACTTTACCATAATATCGAAAGTATAGAGAAGAGTGTTTATGAATCTGTTCAAAATAAAAACAATTCG
CGTGCATTCCTATTCACTCAACCTTATAAAGATATCAACGATGCAGAGGTAAACTATTGGGTTACAGATG
CAGAGGCTGCCAATGGCTTAGATAGCCGTGCCTCTATATATCAATATAATAATGAGAAGTTCTCTTCCAG
TGGATTAGTCTTTCAGACAGAATCCAAACAAGGTAATTCACATAGCGGAGACCAGGAACTCATCAATAGT
TTGCGTTATGGTTTGTTAACAAGAGAACGTATAGTAACGCGCGAGGACGTAAAGAGTTTTCTGCTATGCC
AGTTAGGGCAATGGATAGACTCTATAAAAATAGAAGACGGCATCGCCATTTCGCAAGATGTACGACGAGG
TATTGTCCGAACAACAGAAGTAAAGATTTGCCTCTCACGGGGAGGTAAAGCAGAAAATATAGATTTGCCC
GCAATGACAAACTTCTTGGAAGGAGAGTTGTCAAAGCGTTCAGTTAGTAATACTCCTTATAAGATATTTT
TCGTATGA