SecReT6
Protein ID: 387132040
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0497
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]529214..531655 [+]
Producthypothetical protein
NoteClpV
UniProt IDI1YR66, I1YR66
KEGG IDpit:PIN17_0497
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-48, Aligned region: 199..275
AAA_2 [PF07724], Evalue: 2.10E-48, Aligned region: 551..713
AAA [PF00004], Evalue: 9.10E-19, Aligned region: 199..299
AAA [PF00004], Evalue: 9.10E-19, Aligned region: 558..675
ClpB_D2-small [PF10431], Evalue: 2.70E-17, Aligned region: 721..799
AAA_5 [PF07728], Evalue: 4.30E-15, Aligned region: 199..224
AAA_5 [PF07728], Evalue: 4.30E-15, Aligned region: 556..677
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 178..220
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 238..281
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 527..592
Arch_ATPase [PF01637], Evalue: 1.10E-10, Aligned region: 178..337
Arch_ATPase [PF01637], Evalue: 1.10E-10, Aligned region: 557..583
AAA_18 [PF13238], Evalue: 2.40E-08, Aligned region: 199..275
AAA_18 [PF13238], Evalue: 2.40E-08, Aligned region: 558..586
Zeta_toxin [PF06414], Evalue: 5.20E-08, Aligned region: 192..228
Zeta_toxin [PF06414], Evalue: 5.20E-08, Aligned region: 556..610
AAA_22 [PF13401], Evalue: 5.20E-08, Aligned region: 196..310
AAA_22 [PF13401], Evalue: 5.20E-08, Aligned region: 555..578
AAA_17 [PF13207], Evalue: 8.70E-08, Aligned region: 199..241
AAA_17 [PF13207], Evalue: 8.70E-08, Aligned region: 560..594
IstB_IS21 [PF01695], Evalue: 2.60E-07, Aligned region: 195..285
IstB_IS21 [PF01695], Evalue: 2.60E-07, Aligned region: 418..449
IstB_IS21 [PF01695], Evalue: 2.60E-07, Aligned region: 556..579
Sigma54_activat [PF00158], Evalue: 3.00E-07, Aligned region: 178..227
Sigma54_activat [PF00158], Evalue: 3.00E-07, Aligned region: 557..665
AAA_14 [PF13173], Evalue: 4.40E-07, Aligned region: 198..285
AAA_14 [PF13173], Evalue: 4.40E-07, Aligned region: 385..435
AAA_14 [PF13173], Evalue: 4.40E-07, Aligned region: 559..652
ABC_tran [PF00005], Evalue: 1.40E-06, Aligned region: 197..262
ABC_tran [PF00005], Evalue: 1.40E-06, Aligned region: 557..594
AAA_28 [PF13521], Evalue: 1.30E-05, Aligned region: 199..241
AAA_28 [PF13521], Evalue: 1.30E-05, Aligned region: 557..583
RNA_helicase [PF00910], Evalue: 2.30E-05, Aligned region: 199..232
RNA_helicase [PF00910], Evalue: 2.30E-05, Aligned region: 557..578
AAA_33 [PF13671], Evalue: 2.80E-05, Aligned region: 199..266
AAA_33 [PF13671], Evalue: 2.80E-05, Aligned region: 557..575
AAA_3 [PF07726], Evalue: 3.90E-05, Aligned region: 199..229
AAA_3 [PF07726], Evalue: 3.90E-05, Aligned region: 627..656
TrwB_AAD_bind [PF10412], Evalue: 4.90E-05, Aligned region: 192..228
TrwB_AAD_bind [PF10412], Evalue: 4.90E-05, Aligned region: 555..589
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 199..219
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 243..295
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 556..574
Mg_chelatase [PF01078], Evalue: 0.00038, Aligned region: 198..239
Mg_chelatase [PF01078], Evalue: 0.00038, Aligned region: 556..579
T2SE [PF00437], Evalue: 0.00038, Aligned region: 185..228
T2SE [PF00437], Evalue: 0.00038, Aligned region: 554..625
NACHT [PF05729], Evalue: 0.00054, Aligned region: 199..315
NACHT [PF05729], Evalue: 0.00054, Aligned region: 558..581
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 197..224
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 523..575
RuvB_N [PF05496], Evalue: 0.00056, Aligned region: 624..654
AAA_30 [PF13604], Evalue: 0.00058, Aligned region: 190..275
AAA_30 [PF13604], Evalue: 0.00058, Aligned region: 559..579
KAP_NTPase [PF07693], Evalue: 0.00089, Aligned region: 190..223
KAP_NTPase [PF07693], Evalue: 0.00089, Aligned region: 232..276
KAP_NTPase [PF07693], Evalue: 0.00089, Aligned region: 560..596
DUF2075 [PF09848], Evalue: 0.00094, Aligned region: 199..308
DUF2075 [PF09848], Evalue: 0.00094, Aligned region: 559..581
AAA_19 [PF13245], Evalue: 0.00099, Aligned region: 197..219
AAA_19 [PF13245], Evalue: 0.00099, Aligned region: 559..577
Sigma54_activ_2 [PF14532], Evalue: 0.001, Aligned region: 179..258
Sigma54_activ_2 [PF14532], Evalue: 0.001, Aligned region: 554..574
DUF258 [PF03193], Evalue: 0.0015, Aligned region: 195..232
DUF258 [PF03193], Evalue: 0.0015, Aligned region: 557..575
DUF815 [PF05673], Evalue: 0.0019, Aligned region: 197..276
DUF815 [PF05673], Evalue: 0.0019, Aligned region: 407..476
DUF815 [PF05673], Evalue: 0.0019, Aligned region: 557..589
Rad17 [PF03215], Evalue: 0.002, Aligned region: 189..234
SRP54 [PF00448], Evalue: 0.0028, Aligned region: 199..225
SRP54 [PF00448], Evalue: 0.0028, Aligned region: 557..579
Viral_helicase1 [PF01443], Evalue: 0.0038, Aligned region: 201..279
Viral_helicase1 [PF01443], Evalue: 0.0038, Aligned region: 562..642
ResIII [PF04851], Evalue: 0.004, Aligned region: 184..249
ResIII [PF04851], Evalue: 0.004, Aligned region: 528..575
ResIII [PF04851], Evalue: 0.004, Aligned region: 721..749
KaiC [PF06745], Evalue: 0.0046, Aligned region: 196..210
KaiC [PF06745], Evalue: 0.0046, Aligned region: 214..326
NB-ARC [PF00931], Evalue: 0.0046, Aligned region: 182..224
NB-ARC [PF00931], Evalue: 0.0046, Aligned region: 546..573
Miro [PF08477], Evalue: 0.0054, Aligned region: 199..258
Miro [PF08477], Evalue: 0.0054, Aligned region: 558..579
UPF0079 [PF02367], Evalue: 0.0061, Aligned region: 199..227
UPF0079 [PF02367], Evalue: 0.0061, Aligned region: 559..577
Elong_Iki1 [PF10483], Evalue: 0.007, Aligned region: 239..315
PIF1 [PF05970], Evalue: 0.0074, Aligned region: 184..299
PIF1 [PF05970], Evalue: 0.0074, Aligned region: 553..577
PduV-EutP [PF10662], Evalue: 0.0076, Aligned region: 198..219
PduV-EutP [PF10662], Evalue: 0.0076, Aligned region: 557..576
MobB [PF03205], Evalue: 0.0077, Aligned region: 199..219
MobB [PF03205], Evalue: 0.0077, Aligned region: 558..581
Protein Sequence: 813 a.a.     [Download]
>gi|387132040|ref|YP_006298013.1| hypothetical protein PIN17_0497 [Prevotella intermedia 17]
MNTQNCSNSLLSAIKLAKAMAHQDKHLSYGVAHLVIAMLTEQTGLRDILTSMQKEVSYISDWFETYREMY
VSVEHDSDEIIPDHEVEMILDEAERSKIKLGTDSVDALCVFTAIIRDGVVYSHQQIESIGVSENEVMEYF
DAATSPLSPVAEMDMGCSIQYVSDLRRAELLEEGKSIIGRSKEIRLILETLERSDRQGILLVGAPGVGKT
GVIRALAHEMEINQDEIINQTSLVGLNTSKILAQSSNETEITQKITTLLQKMNQAKSRGVLVIDDLQLLL
ESGNPTAATYILNNLDAQICDGAVTLLLVLSRDAYRKHIEKHSIANRLNIIDVEELEPNILRSALLQHRT
LLQAYYSLPMTEEAFISAYNLSNRYYKERSQPASTLDLVDSTAASVRLSNKNAVGIVEQLVAQYEKYKGM
AIDEVNDYDLHLLYHTIFNKVSVVLTSKIEDDFVLTDDDSTQEKLDKLGKMLKELITISQKGIESVSSLE
IESVVADDTGIPIGKIQAQEKDRLLGIETKLHERVKGQDKAIRTLSDAIIESRSGLSDPKKPIGSFFFLG
PTGTGKTELTKSLADLLFDDDTAMIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGLLVTKIRQKPYSVVL
FDEIEKAHSSVYDIFLQIMDEGKVHDKLGREGDFSNAIIIFTSNIGSQWIAQQIQEGHQPTSNELIEVMS
KYFRPEFLGRLTEVVPFSPITEAVAQQIFLLQFSRLQKQLLEQKDIQLELAPETIAYLTSKGFSPQYGAR
PIAGVVRTYLKKTISKLIVSEAIKPGDHIIATYKDGNLQWNHA
 
Nucleotide Sequence: 2442 bp     [Download]
>gi|387131618|ref|NC_017860.1|:529214-531655 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGAACACACAAAATTGTAGCAATAGCTTGTTATCTGCCATTAAGTTGGCAAAGGCAATGGCGCATCAAG
ATAAGCACTTGTCGTATGGAGTAGCACATCTTGTCATCGCCATGCTGACGGAGCAGACAGGCCTACGCGA
CATCTTAACTTCTATGCAAAAAGAGGTGTCATATATTAGCGATTGGTTTGAAACTTACCGAGAAATGTAT
GTCTCTGTAGAACATGACTCTGACGAAATCATTCCCGACCATGAGGTAGAAATGATACTTGATGAGGCAG
AACGTTCGAAAATAAAACTGGGCACAGATTCAGTAGATGCGCTTTGTGTGTTTACAGCCATTATCAGAGA
TGGCGTGGTATATTCCCATCAGCAGATAGAGTCTATCGGCGTGTCAGAGAATGAAGTCATGGAATACTTT
GACGCAGCAACCTCTCCCCTATCTCCTGTTGCAGAAATGGATATGGGCTGCTCTATTCAATATGTGTCAG
ACCTTCGCCGTGCAGAATTGTTGGAAGAGGGTAAATCTATTATTGGACGTAGTAAGGAAATTCGTTTAAT
ATTAGAAACATTAGAGCGTTCGGACCGACAGGGAATCCTTCTCGTGGGTGCTCCTGGAGTTGGTAAGACA
GGAGTGATTAGAGCACTTGCACATGAGATGGAAATCAATCAAGACGAGATTATTAATCAGACATCATTGG
TTGGGCTTAACACCTCAAAAATATTGGCACAATCTTCCAACGAAACAGAGATTACACAGAAAATTACAAC
TCTGTTGCAAAAGATGAATCAGGCAAAAAGCCGTGGTGTCTTGGTTATTGATGATTTGCAACTACTTCTG
GAAAGTGGAAACCCGACAGCAGCAACGTATATTCTCAACAATCTCGATGCACAGATTTGCGATGGTGCTG
TTACGTTGTTGTTGGTTCTTTCAAGAGATGCCTATCGTAAGCACATAGAGAAGCATTCTATTGCCAACAG
GCTGAATATCATTGATGTAGAAGAGTTGGAACCGAACATATTGCGCAGTGCTTTGTTGCAGCATAGAACT
CTGTTGCAGGCATATTACAGTCTGCCTATGACGGAAGAAGCCTTTATCAGTGCCTATAATCTCTCTAATA
GATATTATAAGGAAAGAAGCCAGCCAGCTTCAACATTAGATTTGGTTGATAGTACGGCAGCTTCTGTAAG
ACTGAGCAATAAAAATGCAGTAGGCATTGTTGAGCAACTCGTTGCACAATATGAGAAGTACAAGGGAATG
GCAATAGATGAGGTCAATGACTATGACCTTCACCTTCTTTATCACACCATATTCAACAAAGTAAGTGTTG
TTCTGACATCAAAGATAGAGGACGATTTTGTCTTGACCGACGATGATTCGACTCAAGAGAAATTGGACAA
GTTGGGGAAAATGCTGAAAGAACTTATAACCATCTCACAAAAAGGCATAGAAAGTGTAAGTTCTTTGGAA
ATAGAATCGGTTGTGGCAGACGACACAGGAATACCAATCGGAAAGATTCAGGCACAAGAAAAGGACAGAC
TTTTGGGTATAGAAACCAAATTGCATGAAAGAGTGAAGGGACAAGATAAGGCTATACGCACGCTCTCAGA
TGCAATTATTGAATCGCGTAGTGGACTTAGCGACCCTAAAAAGCCTATCGGTTCATTCTTCTTCCTCGGC
CCGACAGGTACTGGTAAAACCGAACTCACAAAGTCACTTGCCGACTTACTATTCGATGATGATACGGCAA
TGATTCGCTTTGATATGTCAGAGTTCAAGGAAGAACATTCTGCAGCTTTGCTCTATGGTGCTCCTCCTGG
ATATGTGGGCTATGAGGAAGGTGGTCTTCTTGTAACGAAAATACGCCAGAAACCTTATTCTGTTGTTCTC
TTTGATGAAATTGAGAAGGCACATAGTAGCGTCTATGATATCTTCCTTCAGATTATGGACGAAGGAAAGG
TGCATGACAAATTAGGACGTGAGGGAGATTTCTCCAATGCAATTATCATATTCACATCAAATATTGGTAG
TCAGTGGATTGCACAACAGATTCAAGAAGGACATCAGCCAACCTCCAACGAACTGATAGAGGTTATGTCG
AAGTATTTCAGACCAGAATTCCTCGGACGTCTAACAGAGGTTGTACCGTTCTCTCCAATTACAGAAGCTG
TTGCTCAGCAGATTTTCCTACTTCAGTTCTCACGTTTGCAGAAACAGCTGTTGGAACAGAAGGATATTCA
ATTGGAATTGGCACCAGAAACGATAGCTTATCTGACATCCAAAGGTTTCTCACCACAGTATGGTGCCCGT
CCGATAGCTGGTGTCGTAAGAACCTATCTGAAGAAAACAATTTCAAAGCTGATTGTCTCAGAAGCCATCA
AGCCAGGCGACCACATTATAGCAACTTATAAAGACGGGAATCTGCAATGGAATCACGCATAA