SecReT6
Protein ID: 387132041
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0498
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]531640..532575 [+]
Producthypothetical protein
NoteTssG
UniProt IDI1YRZ7
KEGG IDpit:PIN17_0498
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 311 a.a.     [Download]
>gi|387132041|ref|YP_006298014.1| hypothetical protein PIN17_0498 [Prevotella intermedia 17]
MESRIITPNRNIEDFCNGDARHFIAEVFYAELQFVAGEDLLDKTVAVSHGMNSRVKSQDVIELQKEEVYK
DGQLRERLILHLARNGFYHQLPEFLFHPISLSSPAMSNKEVVEAIRENRKTAEKANRFFSPFDTIMFNDS
VRIFERQLSLFDNPYENIILKKVANLFFSKTAPLTTAERYRLFLCLRRSEYYKENLPALEELLSIVCNID
TQIRYVYHYEDKLPYGSLGDCTLGADSGLDGQLLCELDDVEVKLCFCETIQEEVLKRQMETVRYVLSFFL
LSSRSIKIIYTVTTNTELLLSQNYLGYDTNL
 
Nucleotide Sequence: 936 bp     [Download]
>gi|387131618|ref|NC_017860.1|:531640-532575 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGGAATCACGCATAATAACTCCAAATAGAAACATAGAAGATTTCTGCAATGGCGATGCACGTCACTTCA
TTGCAGAAGTCTTCTATGCTGAATTGCAATTTGTTGCTGGAGAAGATTTGCTTGACAAAACCGTTGCCGT
GAGTCATGGTATGAATAGTCGTGTGAAGTCCCAGGATGTTATAGAGTTACAGAAAGAAGAAGTATATAAA
GATGGACAACTACGAGAACGGCTGATTTTACATCTTGCCCGCAATGGTTTTTACCATCAGTTGCCCGAAT
TTCTGTTTCATCCTATTTCTCTCAGTTCTCCAGCAATGAGCAACAAGGAGGTTGTAGAGGCTATTCGTGA
GAACCGCAAGACGGCCGAGAAAGCAAACCGCTTCTTCTCTCCTTTTGATACGATTATGTTCAATGACAGT
GTACGAATCTTCGAGCGACAGCTGTCTCTGTTCGATAATCCGTATGAGAATATCATACTTAAGAAGGTCG
CCAACCTTTTCTTCTCTAAAACAGCTCCATTGACAACAGCTGAACGATATAGATTGTTTCTGTGTCTACG
TAGGAGCGAATATTACAAAGAGAATCTTCCTGCATTAGAAGAACTGCTTTCTATTGTCTGCAACATCGAC
ACACAGATAAGATACGTCTACCATTATGAGGACAAGTTGCCTTATGGTTCTTTAGGCGATTGCACCTTAG
GTGCCGATTCAGGACTTGATGGCCAGTTATTATGCGAATTAGATGATGTCGAAGTAAAACTATGCTTCTG
CGAAACCATTCAAGAAGAAGTCTTGAAACGGCAGATGGAAACAGTTCGATATGTATTGTCGTTCTTCTTA
CTATCGTCCAGAAGTATAAAAATTATATACACAGTCACAACAAATACAGAACTCCTATTAAGCCAGAACT
ATTTAGGTTATGACACGAACTTATAA