SecReT6
Protein ID: 387132042
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0499
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]532585..533469 [+]
Producthypothetical protein
NoteTssN
UniProt IDI1YQY7
KEGG IDpit:PIN17_0499
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 294 a.a.     [Download]
>gi|387132042|ref|YP_006298015.1| hypothetical protein PIN17_0499 [Prevotella intermedia 17]
MKSLIPFFLKYLLAPLLAMIMVFIMGALKSIRQQLSVKRIIVFSLLAGLFLGLPSLFGFLKNEYVWEGLV
LTVISYLVLGFVYLWALRTFISKKNDDLFMEILVVVLSGGIGMWIYYLVFDWTSDGLDYAPWAMTAVCWF
MIPYFVFRSFKFFQNIQPPIYDLWRINHSGFNRNYWDTLDTFKATTVKVKLKRNVGDYGYAILSVRLAEG
IALGDWFDWLVEDQNRRFPQAQIDINMDDAESGWIFYTSKWFKYPLFIRMLDPRCTASENNIKKDQIIYI
KRVKSINHIQHEED
 
Nucleotide Sequence: 885 bp     [Download]
>gi|387131618|ref|NC_017860.1|:532585-533469 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGAAATCATTAATACCTTTTTTTCTAAAATATTTATTAGCTCCACTCCTTGCCATGATTATGGTATTCA
TTATGGGGGCGTTAAAATCTATTAGGCAGCAACTAAGTGTAAAACGAATTATCGTATTCTCTTTACTGGC
TGGACTTTTTCTCGGACTTCCGTCTCTCTTCGGCTTCTTGAAGAATGAATATGTTTGGGAAGGTCTTGTA
CTAACAGTTATTTCCTACCTCGTCTTAGGCTTTGTCTATTTGTGGGCATTACGAACGTTTATCAGCAAGA
AAAATGATGATTTGTTTATGGAAATCCTTGTGGTAGTACTGTCTGGAGGTATTGGAATGTGGATTTATTA
TCTTGTTTTTGACTGGACCAGTGATGGATTGGACTATGCCCCATGGGCTATGACCGCAGTATGTTGGTTC
ATGATTCCATATTTTGTATTTCGAAGCTTTAAGTTCTTTCAGAACATACAACCACCCATTTATGATTTAT
GGAGAATTAATCATAGCGGTTTTAACCGCAACTACTGGGACACTCTCGATACGTTTAAGGCTACAACAGT
AAAAGTAAAACTTAAAAGAAATGTTGGCGATTATGGATATGCAATCCTTTCTGTTAGATTGGCAGAGGGT
ATAGCCTTGGGAGACTGGTTCGACTGGTTGGTGGAAGACCAAAACCGCCGTTTTCCACAAGCCCAAATTG
ACATTAATATGGATGATGCAGAAAGTGGCTGGATATTCTATACAAGTAAATGGTTTAAATACCCATTATT
CATTAGAATGTTGGATCCACGTTGCACAGCTTCCGAAAATAACATCAAGAAAGATCAAATTATTTATATA
AAACGAGTAAAAAGTATAAATCACATACAACATGAAGAAGATTGA