SecReT6
Protein ID: 387132043
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0500
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]533474..534607 [+]
Producthypothetical protein
NoteTssK
UniProt IDI1YRL4
KEGG IDpit:PIN17_0500
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 377 a.a.     [Download]
>gi|387132043|ref|YP_006298016.1| hypothetical protein PIN17_0500 [Prevotella intermedia 17]
MPINWVNGQKINNSHFFETYYNVIEMLRQNREESLTSYNYGFGEKLEKAQSSIDLDIKGETAETLNVQLK
SCNAVTRNGFHILFTKELYGDFTPECTLNGVDIDLAARQVLCILLTVNPYKMLPVGIPDPETTPLHHPYV
LPEITIQLVLEQNLNKAFLEGNSIIAGKIVVDGGAFTTDIDYIPAIQRIDCSEKAITFLEYMTTTLERIH
DNALKVYSKNVSNPHRSILADNTFAICDVVKNFYGRHIFELKNIVKEQSPVHIVHLANALANLMLTSLRS
LPEKDFETLLQYFDEWTNIKPSDFMHKTSSIAHLEYNHLEINILFTEIASFLNIIDTLFHKLSELEYVGL
IKENIIISEDNNGKASENERKSWKVWD
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|387131618|ref|NC_017860.1|:533474-534607 Prevotella intermedia 17 chromosome chromosome I, complete sequence
TTGCCAATAAACTGGGTAAACGGACAAAAGATTAATAATTCCCATTTCTTTGAGACCTACTACAACGTAA
TAGAGATGTTAAGACAGAATCGGGAAGAAAGTCTTACAAGTTACAACTATGGTTTTGGAGAGAAATTAGA
AAAAGCTCAAAGTTCTATTGATTTAGACATAAAGGGCGAAACTGCTGAAACTCTGAACGTGCAGCTGAAG
TCATGCAACGCCGTTACCCGAAATGGGTTCCACATCCTGTTCACAAAAGAATTATATGGCGATTTCACCC
CTGAATGTACATTGAATGGAGTTGATATCGACCTCGCTGCACGACAGGTTCTATGTATTCTCCTGACAGT
AAATCCTTACAAGATGCTTCCTGTGGGAATTCCAGATCCAGAAACAACACCCCTACATCATCCGTATGTC
TTGCCAGAGATTACCATTCAGCTTGTTTTAGAGCAAAATCTGAACAAAGCTTTTCTTGAAGGTAATAGTA
TAATTGCTGGCAAAATTGTCGTTGATGGTGGAGCGTTCACTACTGATATTGATTACATTCCAGCTATTCA
GCGAATAGATTGCTCTGAAAAAGCTATAACTTTCTTAGAGTATATGACAACAACGCTGGAAAGAATTCAT
GATAATGCCTTGAAGGTATATTCCAAGAATGTATCTAACCCTCATCGCAGTATCTTGGCTGACAACACCT
TTGCCATATGCGATGTGGTTAAGAACTTTTATGGACGACACATCTTTGAACTGAAGAATATAGTCAAAGA
GCAATCACCAGTCCACATTGTGCATCTTGCCAATGCACTTGCAAATTTAATGCTGACATCTCTACGTTCC
TTACCAGAAAAGGACTTTGAAACACTTCTGCAATATTTCGATGAATGGACAAATATCAAGCCATCTGACT
TTATGCACAAGACAAGTAGCATCGCACATTTAGAATATAACCATTTAGAAATAAATATTCTATTTACAGA
GATTGCATCTTTCCTAAATATCATTGACACTCTCTTCCATAAGTTAAGCGAATTGGAATATGTCGGTCTT
ATCAAGGAGAATATCATCATCAGTGAGGACAATAACGGCAAGGCTTCTGAGAACGAAAGAAAATCGTGGA
AGGTTTGGGATTAA