SecReT6
Protein ID: 387132044
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0501
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]534622..535107 [+]
Producthypothetical protein
NoteTssO
UniProt IDI1YQX7
KEGG IDpit:PIN17_0501
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 161 a.a.     [Download]
>gi|387132044|ref|YP_006298017.1| hypothetical protein PIN17_0501 [Prevotella intermedia 17]
MTEKNKKERRQAMNSFAFIFGFTLLLFALFAVCTLKTAERGISMLDEKKARYDEIFRKQAGYNFRIDEML
KDMNNLATRERTDNEKAQYQMIITRHRQEMQDEINQAEADTTNYTLYNVLFNQLQATQETTPTYFEEKSR
LDYLTGQIQKAQDILDKRNIR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|387131618|ref|NC_017860.1|:534622-535107 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGACTGAAAAGAATAAAAAAGAGCGCCGACAAGCAATGAATTCTTTTGCTTTCATCTTTGGATTCACAT
TACTACTCTTTGCTCTCTTTGCCGTTTGCACACTGAAAACGGCAGAGCGCGGAATAAGTATGTTGGACGA
GAAGAAAGCACGGTATGATGAGATTTTCAGAAAACAGGCTGGATACAATTTCCGTATAGATGAGATGCTC
AAAGATATGAATAATCTTGCTACACGGGAACGTACAGACAATGAGAAAGCACAGTACCAAATGATTATCA
CCCGTCATAGGCAAGAGATGCAGGACGAAATAAATCAAGCGGAGGCTGACACAACCAATTATACTCTCTA
TAATGTCTTGTTCAATCAACTGCAGGCAACACAGGAAACAACTCCAACCTACTTTGAGGAGAAGAGTCGC
CTCGACTACCTTACAGGACAAATTCAGAAAGCTCAGGACATTTTAGATAAAAGAAATATAAGATAA