SecReT6
Protein ID: 387132046
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0503
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]535575..536549 [+]
ProductPKD domain-containing protein
NoteTssP
UniProt IDI1YRH3
KEGG IDpit:PIN17_0503
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 1.40E-14, Aligned region: 46..101
PKD [PF00801], Evalue: 1.40E-14, Aligned region: 133..185
Filamin [PF00630], Evalue: 2.80E-05, Aligned region: 30..107
Filamin [PF00630], Evalue: 2.80E-05, Aligned region: 134..146
Filamin [PF00630], Evalue: 2.80E-05, Aligned region: 169..187
Protein Sequence: 324 a.a.     [Download]
>gi|387132046|ref|YP_006298019.1| PKD domain-containing protein [Prevotella intermedia 17]
MTERQKIILAIVSALAVAGLLVALLLPSRTIDRKLDFYIQDQNANNQLEVNEPLKFTINDSSAVADKRVL
WKMGNGDSIVGHPNISYTYRQTGKYLVTLQVDGKIITEKTIDVVKITKDTVAVDSIPKIVGPTQGFVGEK
LVFSADGDRMTSWLWEFGESGTIDAFERQVVYKYDEPGKYLVKLKTNTTLYPVSHVITILAKGEDILETP
EEVTPEEPAEPIDTLALVQNDIKKHLQAIANTSTRDRETFYSHRNYIINKYLRGNANQVIVHVNGERYSV
FPDYCQGLHFLESNRYGRVTIDDVKVDDFHHIIKIEVTQRNTRK
 
Nucleotide Sequence: 975 bp     [Download]
>gi|387131618|ref|NC_017860.1|:535575-536549 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGACTGAAAGACAAAAAATCATTCTGGCAATCGTTTCGGCATTAGCCGTAGCTGGATTATTGGTGGCTT
TGCTTCTTCCATCACGGACTATCGACAGGAAACTGGATTTTTATATTCAGGATCAAAATGCGAATAATCA
GTTGGAAGTAAATGAGCCCCTTAAGTTTACCATCAATGACTCTTCGGCTGTAGCTGATAAAAGAGTACTA
TGGAAGATGGGAAATGGTGATAGCATTGTTGGACATCCCAATATCAGCTATACCTATCGCCAAACTGGTA
AGTATCTCGTAACACTGCAAGTTGATGGTAAAATTATTACAGAAAAGACCATTGATGTTGTCAAAATCAC
AAAAGACACTGTTGCTGTCGACTCTATCCCAAAGATTGTAGGTCCGACACAAGGTTTCGTTGGTGAGAAA
CTCGTATTCTCAGCTGATGGTGACAGAATGACAAGTTGGCTTTGGGAATTTGGTGAAAGCGGCACTATTG
ATGCTTTTGAACGTCAGGTTGTTTATAAGTATGACGAGCCAGGCAAGTATCTTGTCAAACTGAAAACCAA
TACCACACTGTATCCTGTATCACATGTTATCACAATCCTCGCAAAAGGAGAAGATATTCTGGAAACACCA
GAAGAAGTAACACCAGAGGAGCCAGCAGAACCTATAGATACACTGGCATTGGTACAGAACGACATCAAGA
AGCATCTACAGGCAATAGCCAATACTAGTACGAGGGATCGCGAAACCTTCTATTCGCACAGAAACTATAT
TATCAACAAATATCTCCGTGGCAATGCCAATCAAGTTATTGTACATGTAAATGGAGAACGTTATAGTGTA
TTCCCTGATTATTGTCAAGGATTGCATTTCCTTGAAAGCAATCGCTATGGCCGTGTAACCATAGACGATG
TAAAGGTGGACGACTTCCATCATATTATCAAAATTGAAGTTACTCAAAGAAATACAAGAAAATAA