SecReT6
Protein ID: 387132051
SecReT6 ID927
T6SS typeiii
Gene symbol-
Locus tagPIN17_0510
StrainPrevotella intermedia 17
Repliconchromosome I [GenBank: NC_017860] [Browse all T6SS(s) in this replicon]
Location [Strand]540778..541941 [+]
Productphage-like baseplate assembly protein
NoteVgrG
UniProt IDI1YRT2, I1YRT2
KEGG IDpit:PIN17_0510
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 2.00E-18, Aligned region: 140..225
Phage_GPD [PF05954], Evalue: 0.0048, Aligned region: 40..111
Protein Sequence: 387 a.a.     [Download]
>gi|387132051|ref|YP_006298024.1| phage-like baseplate assembly protein [Prevotella intermedia 17]
MDQPTPDLAYGHDQLSGKAFRASLGMYGRPARQHALPRIHTESELIKYMRRKQAADTAETHYVTAESHVP
ELRVGSVVRLYSSFLERVGQLTRESLGDFIITEIVHEVGDGSYYRNRFKAIPSTVEALPSPRVPMPVAET
QMATVTSNADPNGNGRVQVRMNWQQGGMHTGWVRVMTPDAGKSGDVSSNRGFVFIPEVGDQVLLGFRHGD
PGRPYVMGSLFNGSTGGGGGQGNKCKSLTTRSGSSLKLDDSDGSVTLHDKGGVSMNFDGAGNATTSVEAN
HTVNAGSNASTNVGEGASVLNMNSGGSISLSGNKSIAILIGAGQSEVSVSDAEENSIKLKIGSSLIEMKD
GSIDIQSPQITLNGNGGIITQNGDITLKSSGKVIVNK
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|387131618|ref|NC_017860.1|:540778-541941 Prevotella intermedia 17 chromosome chromosome I, complete sequence
ATGGACCAGCCCACCCCTGACCTTGCCTACGGCCACGACCAGCTTTCGGGCAAGGCATTCCGCGCCTCGC
TGGGCATGTACGGCAGGCCTGCGCGCCAGCACGCGCTTCCCCGCATCCACACGGAGTCCGAACTCATTAA
ATACATGCGCCGCAAGCAGGCGGCCGATACCGCCGAGACCCACTACGTCACTGCCGAGAGCCATGTGCCC
GAGCTCCGTGTGGGTTCCGTCGTCCGCCTCTACAGCTCCTTCCTGGAGCGTGTCGGTCAGCTGACCAGGG
AGAGCTTAGGCGACTTCATCATCACCGAGATCGTCCACGAGGTGGGTGATGGCAGCTACTACCGCAACCG
CTTCAAGGCCATTCCCTCTACCGTTGAGGCCCTTCCGAGCCCCCGTGTCCCGATGCCCGTGGCTGAGACG
CAGATGGCGACTGTCACCAGCAATGCCGACCCGAATGGCAACGGCCGCGTCCAGGTTCGCATGAACTGGC
AGCAGGGCGGCATGCACACAGGCTGGGTACGCGTGATGACGCCCGACGCGGGCAAGAGCGGCGACGTGAG
CTCCAACCGCGGTTTTGTGTTTATCCCAGAGGTTGGCGACCAGGTGCTGCTGGGCTTCCGACACGGAGAC
CCTGGGCGTCCCTATGTTATGGGCAGCTTGTTCAACGGTTCCACTGGTGGCGGTGGTGGTCAGGGCAACA
AGTGCAAGAGCCTGACCACACGCAGTGGCAGCTCCCTGAAGCTCGACGACTCAGACGGCAGTGTTACACT
GCATGACAAGGGCGGTGTGAGTATGAACTTTGATGGTGCAGGAAATGCAACAACAAGTGTAGAGGCTAAT
CATACGGTTAATGCAGGAAGTAATGCCTCCACTAATGTTGGCGAAGGTGCAAGTGTGTTAAATATGAATA
GTGGGGGGAGTATCAGCCTTTCAGGAAATAAGTCCATCGCAATATTAATTGGTGCAGGACAAAGTGAAGT
AAGCGTATCTGATGCGGAAGAAAATTCTATAAAACTAAAGATAGGTAGTAGTTTAATTGAAATGAAAGAT
GGTTCTATAGATATCCAAAGTCCACAAATAACACTTAATGGTAATGGTGGAATTATTACTCAAAATGGCG
ACATCACGCTTAAATCATCTGGAAAAGTTATTGTTAATAAATAA