SecReT6
Protein ID: 387605687
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0210
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]243529..244008 [-]
Productputative type VI secretion system protein
NoteTssD
UniProt IDD3GS45
KEGG IDelo:EC042_0210
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-33, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|387605687|ref|YP_006094543.1| putative type VI secretion system protein [Escherichia coli 042]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVMSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLTNARISNIGLTVPHTINDSPGQPEESVSFTYESIN
WEHIVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c244008-243529 Escherichia coli 042, complete genome
ATGGCAAATCCCGTCTATCTGACACTAAACGGAGAACTCCAGGGACTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAGGCCCAGATTGCACATCAGGATCAGATCATGGTGATGTCACTGTCCCATGG
GCTGAGTCGCGCACAGAACGTCAATCACCAGGAACTGACTATCACGAAACCGGTGGACAAATCCTCCCCC
CTTCTGGGCAAGGCCATTTCGGAGAATGAATGTCTGACCTGTGATTTTGTCTTCTATCGCACCAACCGTT
TTGGTATTAATGAGCCGTACTACAAGCTGAAACTGACTAATGCCCGGATCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGCCCAGGGCAGCCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAC
TGGGAGCACATCGTCGCCGGAACCAGTGCGTACAGTCTGTGGAGTGAACGGATTTTCTAA