SecReT6
Protein ID: 387605690
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0213
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]248942..250384 [-]
Productputative type VI secretion system protein
NoteTssA
UniProt IDD3GS48
KEGG IDelo:EC042_0213
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-06, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.10E-06, Aligned region: 152..183
ImpA-rel_N [PF06812], Evalue: 3.10E-06, Aligned region: 405..417
Protein Sequence: 480 a.a.     [Download]
>gi|387605690|ref|YP_006094546.1| putative type VI secretion system protein [Escherichia coli 042]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNAPELAKATDDLFALFQRAFRDVAPEMPSSARTAAIAPQATAGSVPDMSPH
TVAAQPPVAATPIPQVTVDSHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTGFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTAPVVQTDEELQAARACFDENGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRILFRTGLHMMLSEWEPSLLEALEQKFTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c250384-248942 Escherichia coli 042, complete genome
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCGGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACCTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAACACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCTCCTGAGC
TGGCTAAGGCGACAGACGATTTATTTGCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGCC
ATCATCTGCACGAACCGCCGCCATTGCGCCGCAGGCCACAGCCGGATCTGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACTGTTGACAGCCACGACGATA
AAGCATGGCGCGACACCCTGCTGAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCTCTGTGGCAGACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGGTTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGCCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAGGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATACTCTTCAGAACAGGATTACACATGATGCTGTCCGAATGGGAACCGTC
CCTGCTGGAAGCACTGGAACAAAAATTCACGGCAGAACAGTAA