SecReT6
Protein ID: 387605692
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0215
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]251129..253861 [-]
Productputative type VI secretion system protein
NoteTssH
UniProt IDD3GS50
KEGG IDelo:EC042_0215
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.90E-39, Aligned region: 27..46
AAA_2 [PF07724], Evalue: 7.90E-39, Aligned region: 258..258
AAA_2 [PF07724], Evalue: 7.90E-39, Aligned region: 633..794
AAA [PF00004], Evalue: 7.10E-17, Aligned region: 221..332
AAA [PF00004], Evalue: 7.10E-17, Aligned region: 445..504
AAA [PF00004], Evalue: 7.10E-17, Aligned region: 639..756
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 438..488
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 638..758
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 262..298
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 419..498
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 609..679
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 704..732
ClpB_D2-small [PF10431], Evalue: 1.70E-11, Aligned region: 800..876
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 445..480
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 637..672
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 452..486
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 633..667
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 765..830
AAA_14 [PF13173], Evalue: 8.00E-05, Aligned region: 220..319
AAA_14 [PF13173], Evalue: 8.00E-05, Aligned region: 638..728
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 220..247
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 282..343
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 414..451
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 476..502
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 639..667
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 56..71
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 632..660
AAA_29 [PF13555], Evalue: 0.00016, Aligned region: 212..238
AAA_29 [PF13555], Evalue: 0.00016, Aligned region: 636..663
DUF258 [PF03193], Evalue: 0.00019, Aligned region: 186..237
DUF258 [PF03193], Evalue: 0.00019, Aligned region: 639..657
Clp_N [PF02861], Evalue: 0.00096, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.00096, Aligned region: 106..123
AAA_18 [PF13238], Evalue: 0.0056, Aligned region: 221..240
AAA_18 [PF13238], Evalue: 0.0056, Aligned region: 639..673
Zeta_toxin [PF06414], Evalue: 0.0088, Aligned region: 220..239
Zeta_toxin [PF06414], Evalue: 0.0088, Aligned region: 637..678
IstB_IS21 [PF01695], Evalue: 0.0096, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0096, Aligned region: 638..649
Protein Sequence: 910 a.a.     [Download]
>gi|387605692|ref|YP_006094548.1| putative type VI secretion system protein [Escherichia coli 042]
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHMLLQMLVIPRSDVRVIAERTGISAEDLRQA
LTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLTLLHSPLRYIPPAAARLLTAI
NRDQLQQDFTAWTKESAESVDLAGGQAFRATETGDTLLARYAKNMTEDARNGKLDPVLCRDHEIDLMIDI
LCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLM
AEVISSPVPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRF
QLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACARVAI
NLSSPPKQISALATLSQQQETEIRQLERERRIGLRTDTARMTEVLVQYDETLTALDELEAAWHQQQALVQ
EIITLRQQLLGVAEDTDAVVDTPPESEQDNTGAIPADEAGSVQPEETAETVSPVQRLAQLTAELDALHND
RLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRR
PGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLT
EAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPE
TMQEALYPVLADFFKPALLARMEVVPYLPLSKATLATIIAGKLARLDNVLRSRFGADVIIEPEVTDEIMS
RVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSVADGAFTADVEDVLNDESVTEDETVL
 
Nucleotide Sequence: 2733 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c253861-251129 Escherichia coli 042, complete genome
ATGATCCAGATTGATTTAGCCACGCTGGTAAAGCGGCTTAACCCCTTTGCAAAACAGGCGCTGGAAATGG
CTGCCTCGGAGTGTATGAGCCAGCAGGCCAGTGAGATCACCGTTGCCCATATGCTGTTGCAGATGCTGGT
TATCCCGCGCAGCGACGTAAGGGTGATTGCCGAACGCACAGGCATCAGTGCGGAGGATTTACGCCAGGCG
CTGACCGTGGAGAGTTATCCCGGCGGACGTTCCGCCGAAGGCTATCCCAGCTTCTCCCCGATGCTGATCG
AATGGCTCAAGGAGTCATGGCTGCTGGCCTCAGCCCAGATGCAGCACAGCGAACTGCGCAGCGGCGTCCT
GCTGCTTACTCTGCTGCATTCACCGCTGCGCTATATTCCACCCGCTGCTGCCCGTCTGCTGACGGCCATA
AACCGTGACCAGTTACAGCAGGATTTCACCGCATGGACAAAAGAATCCGCCGAATCCGTGGATCTGGCTG
GTGGGCAAGCGTTCCGTGCAACAGAAACCGGCGACACCCTGCTTGCCCGCTATGCCAAAAATATGACCGA
AGACGCCCGTAACGGAAAACTCGATCCGGTACTGTGCCGCGACCACGAAATCGATTTGATGATCGACATT
CTCTGCCGCCGTCGTAAAAATAACCCGGTGGTAGTGGGCGAAGCGGGCGTGGGCAAAAGCGCACTGATTG
AAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCT
TGACCTGGGCGCATTGCAGGCCGGAGCGTCGGTGAAGGGCGAATTCGAAAAACGTTTCAAAGGGCTGATG
GCGGAGGTCATTTCCTCCCCGGTGCCGATCATTCTGTTTATCGACGAAGCGCATACCCTGATTGGCGCGG
GCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGTGGCGAACTGAAAAC
CATCGCCGCCACAACCTGGAGCGAATACAAAAAATACTTCGAAAAAGACGCTGCCTTATCGCGCCGCTTC
CAGTTAGTTAAGGTCAGCGAACCTAACGCTGCCGAAGCGACGATTATTCTGCGTGGCCTGTCGGCGGTCT
ATGAACAGTCTCACGGTGTGCTGATTGACGATGAGGCCTTACAAGCCGCAGCAACACTGAGCGAGCGTTA
TCTCTCCGGACGTCAGTTGCCGGACAAAGCGATTGATGTGCTGGACACCGCCTGCGCCCGCGTGGCAATC
AACCTTTCTTCGCCGCCGAAACAGATTTCGGCGCTGGCCACGTTAAGCCAGCAGCAGGAGACGGAAATCC
GCCAGCTTGAGCGCGAAAGGCGTATCGGGCTGCGTACCGATACCGCCCGGATGACGGAAGTGCTGGTGCA
GTACGATGAAACACTGACGGCGCTGGATGAACTGGAAGCCGCCTGGCACCAGCAACAGGCGCTGGTACAG
GAGATTATTACGCTACGCCAGCAGTTACTGGGCGTTGCAGAGGACACAGATGCCGTAGTGGATACGCCGC
CAGAGTCAGAACAGGATAATACTGGTGCCATACCGGCTGATGAAGCTGGCAGCGTACAGCCGGAAGAGAC
CGCTGAAACAGTTTCCCCGGTACAGCGGCTGGCACAGCTTACTGCCGAACTGGACGCCCTGCATAACGAT
CGGTTGCTGGTCTCTCCGCATGTCGATAAAAAACAGATTGCGGCGGTAATTGCCGAATGGACTGGTGTTC
CGCTTAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGACCTGCCGAAGTGGCTTGGTGACACCAT
CAAAGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACCGCACGCGCCGACCTGCGCCGT
CCGGGACGCCCGCTTGGCGCGTTTCTGCTGGCTGGTCCCAGTGGCGTGGGTAAAACCGAAACCGTCCTGC
AACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAA
GCACACCGTCTCGCGGCTGATTGGTTCCCCTCCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGACT
GAGGCCATCCGCCAGAAACCCTACTCGGTGGTACTTCTCGATGAAGTGGAAAAAGCGCACCCGGATGTGC
TCAACCTGTTCTACCAGGCGTTTGACAAGGGCGAGATGGCGGACGGCGAGGGCCGCCTGATTGACTGTAA
AAACATCGTCTTCTTCCTCACCTCCAACCTCGGCTATCAGGTGATTGTCGAACACGCCGATGACCCGGAA
ACCATGCAGGAAGCCCTGTATCCGGTGCTGGCAGACTTCTTTAAACCCGCCCTGCTGGCGCGTATGGAAG
TGGTGCCATACCTGCCGCTGTCGAAAGCGACGCTCGCTACCATTATTGCCGGGAAACTGGCCCGCCTGGA
TAACGTGCTGCGCAGCCGCTTTGGTGCGGACGTGATTATTGAACCGGAAGTGACGGACGAAATCATGAGC
CGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTCGAATCGGTCATTGACGGCGACATGCTGCCGCCGC
TCTCGCTGCTGCTGTTGCAGAAAATGGCGGCTAACACGGCGATTGCCCGGATTCGCCTGTCGGTGGCAGA
CGGTGCATTCACAGCAGACGTGGAAGATGTTCTGAACGACGAGTCCGTCACAGAGGATGAAACGGTTTTA
TGA