SecReT6
Protein ID: 387605693
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0216
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]253871..254644 [-]
Productputative type VI secretion system protein
NoteTssL
UniProt IDD3GS51
KEGG IDelo:EC042_0216
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-62, Aligned region: 36..240
Protein Sequence: 257 a.a.     [Download]
>gi|387605693|ref|YP_006094549.1| putative type VI secretion system protein [Escherichia coli 042]
MSDISDMGEPSVFPMEPESGTSGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFAQVVT
DVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLER
LIREPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGR
YQLIRRLTIRHVLCGGLVVLAVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 774 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c254644-253871 Escherichia coli 042, complete genome
ATGAGCGATATCAGCGATATGGGTGAACCGTCGGTTTTTCCCATGGAGCCGGAGAGCGGAACATCAGGAC
GTCAGTACCGTCTCGCCCTTCGCGGCAACAGCCTGAACCCAATGATTGACGCCGCCACGCCGTTGCTCGG
CATGGTGATGCGTCTGTCCACCATGAACAGCCAGGCCATGCCGGAACATCTGTTTGCCCAGGTGGTAACC
GATGTCCAGGCTGTGGAACAACTACTCCAGGAGCAGGGTTACGAGCCGGGCGTCATTGTTTCGTTCCGCT
ACATTCTCTGCACGTTTATTGACGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATAAA
ACAGTCGCTACTGGTTCATTTCCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGC
CTGATCCGGGAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGCTTTTCGCTGGGCTTTC
GCGGGCGCTACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGC
CCTGCACAAACTGCGCGGTGACGCGCCATTTCCGCTGCTTCACCAGAAGAACAACATACAGGGCGGGCGT
TATCAGTTAATCCGGCGGCTGACCATCAGGCATGTACTGTGCGGCGGTCTTGTTGTGCTGGCCGTATTTT
ATCTGTTTTATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCG
ATAA