SecReT6
Protein ID: 387605694
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0217
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]254649..255995 [-]
Productputative type VI secretion system protein
NoteTssK
UniProt IDD3GS52
KEGG IDelo:EC042_0217
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-140, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|387605694|ref|YP_006094550.1| putative type VI secretion system protein [Escherichia coli 042]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLNRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRHQMQFTHRSQLHTLHPEAFYQDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATISDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPWHEGYVYFELEKGTPAWQ
DVIKAGALALHISGTFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c255995-254649 Escherichia coli 042, complete genome
ATGGCAACAATGAAAAACAAGGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCATTGCGAGTACCTGCTGAACCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGCTTTAC
GGAACTCTCCATCAATACCGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCTGTAATCAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCGGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACCCTCCCCCTGTGCCGTATCCTCAATAAAAATGCTACCGGCGCACTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGGCTGCTTGCCACCCGCGCCGCCGACCTGGCCGGGCGCATCGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCCATCAAATGCAGTTCACGCACCGTTCACA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCAAGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCACTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGCT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAGCGATCCCACACTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCAAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACTCTTACCGCTGC
GCCGCGTCAGTTGCCCTGGCATGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCAGCCTGGCAG
GACGTGATAAAAGCGGGCGCGCTGGCGCTGCATATCTCCGGCACCTTCCCCGATCTGAACCTTCAGCTCT
GGGCGATAAGGGGATAA