SecReT6
Protein ID: 387605695
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0218
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]255998..256522 [-]
Productputative type VI secretion system protein
NoteTssJ
UniProt IDD3GS53
KEGG IDelo:EC042_0218
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|387605695|ref|YP_006094551.1| putative type VI secretion system protein [Escherichia coli 042]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFQAADYDQIATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIEPVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c256522-255998 Escherichia coli 042, complete genome
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTTGTGTTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGACGGTGAAGCCGCGCCGGTGGATGTCCAG
TTGGTGTATCTGAGCGACGACTCCAAATTCCAGGCCGCCGATTACGATCAGATTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAGAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGACACCGTAAAAACACT
GCCGCCGATCAAGCTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGCCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA