SecReT6
Protein ID: 387605697
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0220
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]257816..258865 [-]
Productputative type VI secretion system protein
NoteTssG
UniProt IDD3GS55
KEGG IDelo:EC042_0220
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-89, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|387605697|ref|YP_006094553.1| putative type VI secretion system protein [Escherichia coli 042]
MAGENGSARPYIATKPPLSADVRNCNFYVLMEALYRRYGAPGQDISLRTEPAQEIVRFSSDANIGFPGTD
LSVLSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRNGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLGDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c258865-257816 Escherichia coli 042, complete genome
ATGGCAGGAGAAAATGGGTCAGCACGCCCTTATATAGCGACAAAACCGCCGTTATCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGTATGGCGCTCCGGGCCAGGATATTTCCCT
GCGTACCGAGCCAGCCCAAGAGATCGTGCGTTTCAGCTCTGACGCCAATATCGGTTTTCCGGGTACGGAC
CTGAGTGTGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGTTTCCTGGGCTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCCGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAACGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTGGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTAGCACCACAGCAGGCTAAAGGGATGCGCCTTGGCGATCCTGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA