SecReT6
Protein ID: 387605698
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0221
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]258829..260670 [-]
Productputative type VI secretion system protein
NoteTssF
UniProt IDD3GS56
KEGG IDelo:EC042_0221
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|387605698|ref|YP_006094554.1| putative type VI secretion system protein [Escherichia coli 042]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSALAAQKVLSDNHDKIVSSVACHF
TLARDIWLQPLRILDTHNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEYRLPLPDLWLEAAGFENQDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
ASAFTLRLHFNRPLPADIKLRRDSLRLHCTPAINLFTHYAEPVRPDGRIAEYPLRASHRHPDAYDIFQIS
TVTSKVKVSGTESNPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLFHRGLEHSIAFVHADGSIP
DSSRFNDDVITTSLICTNRMIPARLHIGDICVAVNKNPAVASFHNVTRPTQPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQEAWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c260670-258829 Escherichia coli 042, complete genome
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGCTTGGCAAACTGCTGGCGC
AGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGTCAGAAACTTGAGGACGAATTCCCCGAATTCACCCATGGG
CTAATCCGTATGCTGTGGGCAAACTATTTACGCCCAGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAAGTCTGCCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CGCCCTGGCTGCTCAGAAGGTGCTGTCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGTCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGACACCCACAACGCCAGCAGCCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
AACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAACTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGTGGCTGGAGGCCGCCGGAT
TTGAAAACCAGGACGCACTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTATCGGGTACTCCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTTTTTTTCCATCTGCGCGATGTTGCGCCACTACCGGACGATTTCCCG
GCCAGCGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTACGCCGGGACT
CACTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCTGATGG
GCGGATAGCGGAATACCCGCTGCGCGCCAGCCACCGGCATCCCGACGCTTATGACATTTTTCAGATAAGC
ACAGTCACCAGCAAAGTCAAAGTTTCAGGTACTGAATCCAACCCTGGCAGCCAGGCGCGTGTCTGGCCCG
AATTTGAAAGTTTCCAGCACCAGATGGAGTACAGCCGCCAGCGGGAAGTCGTCTACTGGCATCACCGGAC
TAAAACATCCCTGTTTCACCGCGGGCTTGAACATAGTATCGCCTTTGTCCATGCGGACGGCAGCATTCCG
GACAGCTCACGGTTTAATGATGATGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCTC
GGCTGCATATCGGCGATATCTGCGTGGCCGTCAACAAAAACCCGGCGGTGGCCTCATTTCATAATGTCAC
ACGCCCGACGCAGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTATCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGCG
CTCACCATCCGCAGCGGGCCAGACTGTCGCGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTGCCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCA
TTTATCTGCGAAGGTGAAATTTATCTTCTTGGTACAGTGCTCTCGCACTTTTTTGCTCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATCAACACGGAAAGTCAGGAGGCCTGGGAATGGCAGGAGAAAAT
GGGTCAGCACGCCCTTATATAG