SecReT6
Protein ID: 387605700
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0223
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]261106..262590 [-]
Productputative type VI secretion system protein
NoteTssC
UniProt IDD3GS58
KEGG IDelo:EC042_0223
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-182, Aligned region: 67..491
Protein Sequence: 494 a.a.     [Download]
>gi|387605700|ref|YP_006094556.1| putative type VI secretion system protein [Escherichia coli 042]
MSVKEDIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPG
IKEPGAIFEGPAYSRWRALRESEDSRYLGLTAPRFLLRHPYSPDENPARTFRYHEDVSQSHESYLWGNTS
FLLAANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLT
MRKGSDNACFFSANSVQKPKKFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGR
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c262590-261106 Escherichia coli 042, complete genome
ATGTCAGTAAAGGAAGATATTGCTCCCGTCAGCGCGTCGCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAGGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCA
ACTTTGCCTTTAAGAACACCACGCCGGATATGAAGTTGCTGAAATATATCAGCCAGGTCAGTGCGATGGC
GCACAGCCCGTTCCTCTCATCAGTATCATCCGAATTTTTCGGTCTGGACTCATGGACAGAGTTACCAGGG
ATCAAAGAACCAGGAGCAATCTTTGAAGGCCCGGCCTATTCCCGCTGGCGTGCCTTGCGTGAATCTGAAG
ATTCACGCTACCTGGGACTGACTGCCCCCCGGTTCCTGCTGCGTCACCCTTACTCGCCAGATGAGAACCC
AGCCAGGACCTTCCGTTACCATGAAGACGTCAGCCAGAGTCACGAGTCTTATTTGTGGGGGAACACCTCG
TTTTTACTAGCTGCGAACCTGGCTGAAAGTTTTGCTAAATATCGCTGGTGTCCCAATATCATTGGCCCTT
CCAGCGGCGGCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAAT
TCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAAGGCTTTATCACACTGACC
ATGCGTAAAGGATCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAAAATTCCCCA
AAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACTCAGCTGCCATACTTATTTGTAAT
CAGTAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGCAGTGAC
CTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTGGCCGACCAGGAGAATCCGCCTGCCGAAGTCC
GCAGCCACCGACCATTACGTCAGGCGAAGATCGAGGTACTTGATGTGGATGGTGAGCCAGGCTGGTACCA
GGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGTCTGGTCGGACGA
CTGGATAAGGAATAA