SecReT6
Protein ID: 387605701
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0224
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]262613..263116 [-]
Productputative type VI secretion system protein
NoteTssB
UniProt IDD3GS59
KEGG IDelo:EC042_0224
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|387605701|ref|YP_006094557.1| putative type VI secretion system protein [Escherichia coli 042]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDSREQLIQELGIAAQK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c263116-262613 Escherichia coli 042, complete genome
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGACGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCGGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCTCTGGTCGCACTTAAGTCTCCACTAGGCAATATTCCGGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACAGCCGCGAGCAGCTGATCCAAGAACTGGGTATCG
CCGCTCAGAAATAA