SecReT6
Protein ID: 387605704
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0227
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]264558..266516 [+]
ProductType VI secretion system Rhs/Vgr-family protein
NoteTssI
UniProt IDD3GS62
KEGG IDelo:EC042_0227
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-62, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 8.90E-27, Aligned region: 367..459
Protein Sequence: 652 a.a.     [Download]
>gi|387605704|ref|YP_006094560.1| Type VI secretion system Rhs/Vgr-family protein [Escherichia coli 042]
MSLKGLRFTLEIDGQEPDTFAVVHFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATLTIWQGVIPLR
YVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGELPFNPDTSAGAETEC
VSMFRYEAYVRPSSVQSQDYTFKVPDWPGMYEQQGENLNGQLEQYEIFDYPGRFKDEQHGKDFTLYQMES
LRSDAEKATGQSNSPKLWPGTRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVQFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRIGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGFNELRFEDATD
KEEIYLHAQKNMQVVVLNSKDKRVNYDRTVSIGHDESLVVANDRKVTVEGKQDHKTTKDHVSLTEGNQGL
EVKGDLAQKISGALGISVQGDIVLQSDSKISLRVGGSFVVIHSGGVDIKGAKINLNGGGSPGDVILPMRP
VILKAAAGSGTMFVAHCPKEDK
 
Nucleotide Sequence: 1959 bp     [Download]
>gi|387605479|ref|NC_017626.1|:264558-266516 Escherichia coli 042, complete genome
ATGTCCTTAAAAGGTCTGCGCTTTACGCTGGAGATTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGC
ATTTCAGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTTGCCAGCGACTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAAGGCGACGCTGACCATCTGGCAGGGCGTCATCCCGCTGCGT
TATGTCACCGGCGTGGTGGCGGGTTTTGGCATGCAGGAGAACAATGGCTGGCAGATGCGTTATCACCTGC
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCAGAACTTCCGTATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACGTTACTGAACGAGAACGGCGTCACGGAGTGGACACCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTCCAGTACGGGGAAAGCGACCTGGCGTTTCTGGCGCGGTTGTGGGCGGAGG
AGGGAATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGAGAGCTTCCGTTTAACCCGGACACATCGGCAGGAGCGGAGACAGAGTGT
GTCAGTATGTTCCGTTATGAGGCGTATGTCCGCCCGTCGTCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAACCTGAACGGACAGCTGGAGCAGTATGAGAT
ATTTGATTATCCGGGAAGGTTCAAGGATGAACAGCACGGCAAGGATTTCACGCTGTACCAGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCACCGAAGCTGTGGCCGGGAACGCGGTTTA
CGCTGACGGGGCATCCGCAGAAGATGCTGAACCGTGAATGGCAGGTGGTACAGAGTATTCTGTCAGGGGA
CCAGCCGCAGGCGCTGCACGGCAGCCAGGGGAGAGGAACCACGCTGGGAAATCAGTTAGAGGTGATACCG
GCGGACCGGACGTGGCGTCCACGGCTGCAAAGCAAACCGAAGGTGGACGGGCCACAGAGCGCCATTGTCA
CCGGTCCTGCGGGAGAGGAAATCTTCTGCGACGAACACGGACGTGTGCGAGTGCAGTTTCACTGGGACAG
GTATAACCCGGCAACGGAGGCGAGTTCATGCTGGGTGAGGGTGTCGCAGGCGTGGGCGGGGCCGGGATTT
GGTAACCTGGCGATACCGCGCATCGGCCAGGAAGTGATTGTAGACTTCCTGAACGGCGACCCGGACCAGC
CGATAATCATGGGGCGGACGTACCATGAGGACAACCGTTCGCCGGGGAGTCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGCTTTAATGAACTGCGGTTCGAGGACGCGACGGAC
AAGGAAGAAATTTACCTGCACGCACAGAAAAATATGCAAGTCGTTGTGCTGAACAGCAAGGATAAGCGGG
TCAACTATGACCGGACGGTCAGCATCGGGCATGATGAATCCCTGGTGGTGGCAAATGACCGGAAAGTGAC
GGTTGAAGGTAAACAGGACCATAAAACCACCAAAGACCATGTCAGCCTGACAGAGGGCAATCAGGGGCTG
GAGGTGAAAGGCGATCTGGCACAGAAAATAAGCGGCGCGCTGGGTATCAGCGTACAGGGCGATATTGTTT
TACAGAGCGACAGCAAAATCAGTCTGCGGGTGGGCGGTTCATTTGTGGTGATCCATTCCGGCGGCGTGGA
TATTAAGGGCGCGAAAATCAATCTTAACGGCGGAGGCAGTCCGGGAGACGTGATCCTGCCGATGCGCCCG
GTGATCCTGAAAGCCGCAGCCGGAAGCGGGACAATGTTTGTGGCGCACTGCCCGAAGGAGGATAAGTGA