SecReT6
Protein ID: 387609945
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4524
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4852875..4853372 [+]
Productputative type VI secretion protein
NoteTssB
UniProt IDD3GU37
KEGG IDelo:EC042_4524
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.30E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|387609945|ref|YP_006098801.1| putative type VI secretion protein [Escherichia coli 042]
MSSSFQNEIPKARVNLKLDLHTGGGQKKVELPLKLLVAGDFSNGQEERPLSERVKTDINKNNFNDVLADI
SPSVHLNVENTLAGDGSEESISLTFRNMNDFTPEQVARQIPRLKAMLAMRSLLRDLKANLLDNVTFRKEL
EKILRDPALSQTLRDELRALVPEKA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4852875-4853372 Escherichia coli 042, complete genome
ATGAGCAGTTCGTTTCAGAATGAAATCCCGAAAGCAAGGGTAAATCTGAAATTAGACCTACATACGGGTG
GTGGGCAGAAGAAAGTGGAGCTTCCGCTCAAACTTCTGGTTGCCGGTGATTTCAGTAACGGACAGGAAGA
GCGTCCACTGTCAGAGCGTGTAAAAACGGATATTAATAAAAACAATTTTAATGATGTTCTGGCAGATATC
TCCCCGTCTGTACATCTGAATGTGGAGAACACGCTTGCCGGTGATGGCTCTGAAGAGAGCATCAGCCTGA
CTTTCCGCAATATGAACGATTTCACGCCAGAGCAGGTCGCCCGACAGATTCCCCGTCTTAAAGCCATGCT
GGCCATGCGTAGCCTTCTGCGGGACCTGAAAGCCAATCTGCTGGATAACGTGACTTTCCGTAAAGAGCTG
GAAAAAATTCTGCGTGACCCGGCACTGAGTCAGACGCTGCGTGATGAACTGCGTGCACTGGTGCCGGAAA
AGGCGTGA