SecReT6
Protein ID: 387609946
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4525
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4853394..4854938 [+]
Productputative type VI secretion protein
NoteTssC
UniProt IDD3GU38
KEGG IDelo:EC042_4525
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-174, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|387609946|ref|YP_006098802.1| putative type VI secretion protein [Escherichia coli 042]
MLMSVQKEKNVAESVVSEAHAGDSVYASLFEKINLSPVSALSALDIWQDPQAMSEASADERLTAGMQVFM
ECLAKAGTQVEKLDKALIDHHIAELDYQISRQLDAVLHHPEFQKVESLWRGVKSLVDKTDFRRNVKIELL
DLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALVSAWEFDASAQDVALLKNISRVAASAHM
PFIGSVGPAFFQKETMEEVAAIKDIGNHFERAEYIKWNAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHHKYLWTNASFAFAANMVRSFVTNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLPYIFLLSRIAH
YLKIIQRENIGTTKDRRLLELELNNWIRGLVTEMTDPGDELQASHPLRDGKVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVSLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4853394-4854938 Escherichia coli 042, complete genome
ATGCTGATGTCTGTACAGAAAGAAAAGAACGTTGCAGAGAGCGTGGTATCTGAAGCGCATGCCGGCGACA
GCGTATATGCTTCCCTGTTTGAAAAAATTAACCTGAGTCCGGTATCTGCCCTGAGTGCACTGGATATCTG
GCAGGATCCACAGGCCATGTCAGAAGCATCTGCAGATGAACGTCTGACGGCAGGGATGCAGGTGTTTATG
GAGTGTCTGGCAAAAGCCGGCACGCAGGTGGAAAAACTCGATAAAGCGCTGATTGACCATCATATTGCAG
AGCTTGATTATCAGATCAGCCGTCAACTGGATGCTGTGCTTCATCATCCGGAATTTCAGAAAGTGGAGTC
GCTGTGGCGGGGCGTGAAGTCCCTGGTGGATAAAACGGACTTCCGCCGTAATGTGAAAATTGAGCTGCTG
GATCTGTCCAAAGACGATCTGCGTCAGGATTTTGAGGATGCGCCGGAAATTATTCAGAGCGGCCTTTATC
TGCAGACCTATGTGGCTGAGTATGACACGCCGGGTGGTGAGCCCATTGCCGCCCTGGTTTCAGCCTGGGA
GTTTGATGCATCTGCACAGGACGTGGCGTTGCTGAAAAATATTTCCCGGGTGGCGGCATCTGCACATATG
CCGTTTATTGGTTCAGTTGGCCCGGCGTTCTTCCAGAAAGAAACCATGGAAGAGGTGGCTGCCATCAAGG
ATATTGGCAACCACTTTGAGCGTGCCGAGTACATCAAGTGGAATGCTTTCCGTGAGACGGACGATGCCCG
CTATATTGGCCTGGTGATGCCCCGTGTACTGGGACGCCTGCCGTATGGCCCGGATACCGTACCTGTCCGC
AGCTTTAACTATGTTGAAGAGGTGAAAGGACCGGACCACCATAAATATCTCTGGACGAACGCGTCTTTTG
CCTTTGCAGCCAACATGGTGCGCAGTTTTGTCACCAACGGCTGGTGTGTTCAGATCCGTGGGCCTCAGGC
CGGTGGTGCGGTGCAGGATTTGCCAATCCATTTGTATGATCTGGGAACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACGCGGGAGTTTGAATTCGCGAATCTGGGCTTTATTCCGCTCTCTTACT
ACAAGAACCGGGATTATGCCTGCTTCTTCTCTGCTAACTCCGCCCAGAAACCGGCGCTGTACGATACGCC
GGATGCAACGGCGAACAGTCGTATTAATGCCCGTCTTCCCTATATCTTCCTGCTGTCCCGTATTGCGCAT
TACCTGAAGATCATTCAGCGGGAAAATATCGGTACCACCAAAGATCGCCGTCTGCTTGAGCTGGAGCTGA
ATAACTGGATCCGGGGACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCCTCGCATCCGCT
GCGTGACGGAAAAGTGGTGGTGGAAGATATCGAAGACAATCCGGGATTCTTCCGCGTGAAACTCTACGCC
GTACCGCATTTCCAGGTAGAAGGTATGGACGTCAGCCTGTCACTGGTTTCGCAGATGCCGAAGGCAAAAG
CGTAA