SecReT6
Protein ID: 387609947
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4526
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4854954..4856291 [+]
Productputative type VI secretion protein
NoteTssK
UniProt IDD3GU39
KEGG IDelo:EC042_4526
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.20E-126, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|387609947|ref|YP_006098803.1| putative type VI secretion protein [Escherichia coli 042]
MKIYRPLWEDGAFLMPQQFQQQAAWDVHLADSVARMGLAHPWGVVAAEFDDSLLPLSRLNATRLIVRFPD
GTLIDTERADNLPPVCDLSTVSDRSLVDIVLALPLLNANGGNLDNGSESERPRRWKSERVNVQELAGHEQ
SEVAVLRHNLTLRMAHQENAAWLTCPVTRLVRDAQGQWCRDPRFIPPLLTLSASPSLMTELAELLHHLQA
RRQRLMSMRRENNARLADFAVADVSLFWLLNALNSAEPVLKELLDMPYRHPELLYRELARLAGSLLTFSL
EHNVDAVPAYHHETPENVFPPLLSLLNRLLEASLPSRVVFIELKQKGVMWEGALHDARLREGADFWLSVR
SSMPGHELQTKFPQLCKAGSPDDVSEVVNVALSGVIIRPVTHVPAAIPLRLENQYFALDLSTDAARAMLD
AGRCTFYTPASLGDVKLELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4854954-4856291 Escherichia coli 042, complete genome
ATGAAGATTTATCGCCCATTATGGGAAGACGGGGCTTTTCTGATGCCCCAGCAGTTTCAGCAGCAGGCTG
CCTGGGATGTTCATCTGGCAGACAGCGTTGCCAGAATGGGGCTGGCGCATCCATGGGGCGTGGTGGCTGC
AGAGTTTGATGACTCTCTGTTACCGCTTTCACGGTTGAATGCCACCCGTCTGATTGTTCGTTTCCCGGAC
GGAACGCTTATTGATACGGAACGCGCGGATAATCTGCCTCCGGTCTGTGATTTATCGACGGTTTCTGATC
GTTCCCTGGTGGATATTGTGCTGGCACTACCGTTACTGAATGCTAACGGTGGCAACCTTGATAATGGCAG
TGAGAGCGAGCGTCCGCGTCGCTGGAAATCAGAAAGGGTGAATGTGCAGGAGCTGGCCGGGCATGAGCAA
AGCGAAGTGGCGGTATTGCGGCATAACCTGACTCTGCGCATGGCTCATCAGGAAAATGCTGCCTGGCTGA
CCTGTCCCGTTACCCGTCTTGTTCGTGATGCACAGGGACAGTGGTGCAGGGACCCGCGTTTTATTCCCCC
TCTGCTGACGCTGTCTGCCAGTCCTTCGCTGATGACTGAACTTGCGGAGTTGCTTCATCACCTGCAGGCG
CGTCGCCAGCGACTGATGTCCATGCGTCGGGAGAACAATGCCCGTCTTGCGGATTTTGCTGTGGCGGACG
TGTCGTTGTTCTGGTTGCTGAATGCCCTGAACAGTGCGGAGCCTGTTCTGAAAGAGTTGCTTGACATGCC
TTACCGCCACCCGGAACTGTTGTACAGGGAGCTTGCCCGGCTGGCAGGCTCCCTGCTCACATTCTCGCTT
GAGCATAATGTGGATGCGGTTCCGGCATACCATCATGAAACACCTGAAAATGTTTTCCCACCATTGCTTT
CTTTGCTGAACCGGCTGCTGGAGGCAAGCCTGCCTTCCCGTGTGGTTTTCATTGAACTGAAACAAAAGGG
TGTGATGTGGGAGGGGGCATTACATGATGCGCGTCTGCGCGAAGGGGCTGATTTCTGGCTTTCAGTGCGC
TCTTCCATGCCCGGGCATGAACTGCAGACGAAGTTTCCGCAGCTATGCAAAGCCGGGAGCCCCGATGATG
TGTCTGAGGTGGTGAATGTGGCGCTGAGCGGGGTCATTATCCGTCCGGTTACGCATGTACCGGCGGCCAT
TCCGCTCCGGCTGGAAAACCAGTATTTCGCGCTGGATTTAAGTACGGATGCGGCCCGGGCGATGCTGGAC
GCGGGGCGTTGTACTTTCTACACCCCGGCATCGCTGGGAGATGTGAAACTGGAACTTTTTGCGGTGCTGC
GGACATGA