SecReT6
Protein ID: 387609948
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4527
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4856288..4856941 [+]
Productputative type VI secretion protein
NoteTssL
UniProt IDD3GU40
KEGG IDelo:EC042_4527
PDB ID3U66
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-41, Aligned region: 12..206
Protein Sequence: 217 a.a.     [Download]
>gi|387609948|ref|YP_006098804.1| putative type VI secretion protein [Escherichia coli 042]
MNKPVISRAEQIFYPGWLMVSQLRSGQPVEDGKALYRRACQLVKQAREELAEAGFSQKSSDIMLYAFCAL
LDESVLNREKTDDGWRTWQQDPLQAHFFGTLNAGEELWERIREQLKLPAPDVAVLTCLCRTLQLGFTGQY
RSQDDERREDVIRALTARVPAFTFAQDAPVVVRAPGYRAGRTMYWLSWGAGIVTLAGLWCVLSSVLADQV
ARLTGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4856288-4856941 Escherichia coli 042, complete genome
ATGAATAAACCTGTTATCTCCCGGGCTGAACAGATTTTTTATCCCGGCTGGCTGATGGTCAGCCAGCTGC
GCAGCGGGCAACCGGTTGAGGATGGTAAGGCCCTGTATCGCCGTGCCTGTCAGCTGGTGAAACAGGCGCG
TGAAGAGCTGGCCGAAGCAGGATTCAGTCAGAAAAGCAGTGACATCATGTTGTATGCCTTCTGCGCCCTG
CTGGACGAGAGTGTACTGAACCGCGAAAAAACAGACGATGGCTGGCGCACCTGGCAGCAGGACCCGCTGC
AGGCTCATTTTTTTGGTACGCTCAATGCCGGTGAAGAGCTCTGGGAGCGTATTCGTGAACAACTGAAATT
ACCAGCGCCGGATGTGGCGGTACTGACATGCCTCTGCCGTACGCTTCAGCTCGGTTTTACCGGTCAGTAC
CGGTCGCAGGATGATGAGCGTCGCGAAGATGTAATACGCGCACTGACAGCGCGTGTTCCTGCATTTACTT
TCGCACAGGATGCGCCGGTGGTGGTGCGTGCACCGGGTTACCGTGCTGGCAGAACGATGTACTGGTTGTC
ATGGGGGGCGGGTATTGTGACGCTGGCTGGTCTCTGGTGTGTGCTTTCTTCTGTGCTTGCAGACCAGGTG
GCACGGCTTACCGGGCAGGGATAA