SecReT6
Protein ID: 387609949
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4528
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4856944..4858674 [+]
Productputative type VI secretion protein
NoteTagL
UniProt IDD3GUV9, D3GUV9, D3GUV9
KEGG IDelo:EC042_4528
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 9.30E-16, Aligned region: 448..544
OmpA [PF00691], Evalue: 9.30E-16, Aligned region: 448..544
Protein Sequence: 576 a.a.     [Download]
>gi|387609949|ref|YP_006098805.1| putative type VI secretion protein [Escherichia coli 042]
MHVRSRLWLTILSLFLTLWLISGFLPLSAVNQIILTLVSVVAAGLVLWYQWRCLSSRRDIPEKAGDDGLP
PEYFQGHVLLVAGNSDAWFEPGQAYRETASGWYLRVDTPEQMRILAERLSYSRPALCGQVVVMLGLLPEQ
HTSDEAFLSWLRNWQRAVMQCRQWLNTTPPVLVTLMVSEPSPQNTSLNKHSTHWFTLTPDLPGMHIRLTE
AGAIPAEEWLQACDAASRLRCVSELLWLNAMLSWYNRVTDALTAICRQEHFYFRPVAVGFCLTSVAARPG
NLWQQQLTSLTALPPPAGVSSQVLPLPDILLSGIPRHRGLSHWHRLCRQTGAIVGVFLLLAMLASFMNNQ
RLVRSVGEHLTAWHRMRGYSSESKTTALQRLQADSQLLNDWQQRGVPQRYGLGLYQGMWLIPPVERATGE
WVAPRPPRPVIQKVTQTPKTVRLNSLALFDAGKWTLKPGATKWLVNALVDIKAKAGWLIVVSGHTDNTGD
PLRNQALSLKRAEAVRDWMRDTGDIPQSCFAVQGYGESRPVAPNDTAEGRARNRRVEISLVPQADACRLP
DVSPAPEEGASENITE
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4856944-4858674 Escherichia coli 042, complete genome
ATGCACGTACGTTCCCGTCTCTGGCTGACAATACTGAGTCTGTTCCTGACACTGTGGCTGATTTCGGGAT
TCCTGCCGCTGTCTGCAGTAAACCAGATAATACTGACCCTGGTTTCAGTTGTGGCGGCGGGGCTTGTGCT
GTGGTACCAGTGGCGTTGTCTGTCTTCCCGTCGTGATATCCCGGAGAAGGCCGGCGATGACGGTCTGCCG
CCTGAGTATTTTCAGGGACATGTGCTGCTTGTTGCCGGAAACTCAGATGCGTGGTTCGAACCCGGTCAGG
CATACCGGGAAACAGCATCGGGATGGTATCTTCGTGTGGATACGCCGGAGCAGATGAGAATACTGGCAGA
ACGGTTGTCGTACAGCCGTCCGGCCCTGTGTGGCCAGGTCGTGGTCATGCTGGGACTTTTACCGGAGCAG
CATACCTCAGATGAAGCTTTCCTGTCGTGGTTGCGGAACTGGCAGCGTGCAGTCATGCAGTGCCGGCAGT
GGCTGAATACCACGCCACCGGTGCTGGTTACATTGATGGTTTCAGAGCCGTCACCACAAAACACATCCTT
AAATAAGCACTCTACACACTGGTTTACACTGACACCGGACCTGCCGGGAATGCATATACGCCTGACGGAA
GCCGGAGCAATTCCGGCAGAGGAATGGCTGCAGGCGTGTGATGCAGCGTCCAGGCTCCGGTGCGTCAGTG
AACTGTTATGGCTGAATGCCATGTTGTCCTGGTACAACCGGGTTACTGATGCCCTGACAGCTATTTGCCG
GCAGGAGCACTTTTATTTCCGGCCGGTTGCCGTTGGATTCTGTCTGACGTCGGTTGCGGCCCGCCCCGGT
AATCTCTGGCAACAACAACTGACGTCCCTCACTGCATTGCCACCGCCTGCCGGCGTGTCATCACAGGTAT
TGCCGTTGCCGGATATTCTGCTGTCCGGTATTCCCCGTCATCGTGGACTCAGTCACTGGCACAGACTTTG
TCGCCAGACGGGGGCGATTGTCGGTGTTTTTCTTCTGCTGGCTATGCTGGCGTCTTTTATGAATAACCAG
CGGCTGGTTCGCAGCGTGGGGGAACACCTGACGGCCTGGCACCGGATGCGCGGATATTCATCTGAATCGA
AAACAACAGCACTGCAACGTCTTCAGGCTGACAGCCAGTTACTGAACGACTGGCAGCAACGTGGTGTGCC
ACAGCGTTACGGACTGGGATTGTATCAGGGAATGTGGCTGATACCGCCGGTTGAGCGTGCGACTGGTGAG
TGGGTTGCACCACGGCCTCCCCGTCCGGTGATACAGAAAGTTACTCAGACGCCGAAAACGGTTCGCCTTA
ACAGCCTGGCACTGTTTGATGCCGGTAAATGGACGCTGAAGCCGGGCGCCACAAAATGGCTGGTGAATGC
CCTGGTGGATATTAAGGCAAAAGCAGGCTGGCTGATTGTGGTCAGTGGTCACACGGATAATACCGGTGAC
CCGCTGCGCAACCAGGCCTTGTCCCTGAAGCGTGCAGAGGCCGTTCGCGACTGGATGCGGGATACCGGCG
ATATTCCCCAAAGCTGTTTTGCCGTACAGGGATACGGTGAAAGCCGCCCTGTGGCCCCGAATGACACGGC
GGAAGGCCGTGCGCGTAACCGCCGTGTTGAAATCAGTCTGGTACCGCAGGCCGATGCCTGTCGTCTGCCG
GACGTTTCCCCTGCGCCGGAAGAGGGCGCATCAGAAAACATAACGGAGTAA