SecReT6
Protein ID: 387609950
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4529
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4858680..4859171 [+]
Productputative type VI secretion protein
NoteTssD
UniProt IDD3GUW0
KEGG IDelo:EC042_4529
PDB ID4HKH
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|387609950|ref|YP_006098806.1| putative type VI secretion protein [Escherichia coli 042]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKNPAYEKHNHLEQVELRYE
KITWTYKDGNIIHSDAWSERTTA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4858680-4859171 Escherichia coli 042, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGATGATGGCGGTGCAGATATCAAAGGGTCCGTGGATGTTC
AGGACCGTGAGGGCAGCATTGAGGTGGTGGCTCAGGAGCACTGCCTCTACATCCCGACGGATAACAATAC
CGGTAAGCTGACCGGTACCCGTATTCACACGCCGTTTCTGTTTACCAAGGAAATTGATTCTTCCAGCCCG
TACCTTTACAAGGCCGTGACCACCGGGCAGACCCTGAAGTCTGCTGAGTTTAAGTGGTACAAAATCAATG
ATGCCGGTCAGGAGGTGGAGTATTTCAATACGAAGCTTGAGAACGTGAAGGTGGTGAAGGTTAACCCGGT
CATGCACGACATCAAGAATCCCGCTTACGAGAAGCATAACCACCTTGAGCAGGTGGAACTGCGCTACGAG
AAAATCACCTGGACTTACAAGGACGGCAACATCATTCATTCCGACGCATGGAGTGAGCGTACCACCGCGT
AA