SecReT6
Protein ID: 387609958
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4537
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4868837..4869103 [+]
Productputative type VI secretion protein
NotePAAR
UniProt IDD3GUW8, D3GUW8
KEGG IDelo:EC042_4537
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.50E-23, Aligned region: 9..81
PAAR_motif [PF05488], Evalue: 1.50E-23, Aligned region: 9..81
Protein Sequence: 88 a.a.     [Download]
>gi|387609958|ref|YP_006098814.1| putative type VI secretion protein [Escherichia coli 042]
MSKGFVLLGDNTTHGGKVISASSTMIVDGKKVALVGDMVSCPVSGHGTNPIVEGSPEWISDGRAVVIDGC
KCLCGCKVISSAPECAIG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4868837-4869103 Escherichia coli 042, complete genome
ATGTCTAAAGGTTTTGTATTGCTTGGTGATAATACCACACATGGTGGTAAAGTTATTTCTGCATCTTCAA
CCATGATTGTCGATGGTAAAAAAGTAGCTCTTGTTGGAGATATGGTTAGTTGCCCTGTTTCCGGACATGG
TACCAATCCTATTGTGGAGGGCTCTCCTGAATGGATATCTGATGGAAGAGCTGTTGTGATTGATGGATGT
AAATGTCTGTGTGGGTGTAAGGTTATATCCAGTGCACCGGAATGTGCAATAGGATAA