SecReT6
Protein ID: 387609961
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4540
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4873637..4875235 [+]
Productputative type VI secretion protein
NoteTssA
UniProt IDD3GUX1
KEGG IDelo:EC042_4540
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-24, Aligned region: 70..126
Protein Sequence: 532 a.a.     [Download]
>gi|387609961|ref|YP_006098817.1| putative type VI secretion protein [Escherichia coli 042]
MASIHSLLSACQTTPRDVAEPAQVRIALWDKWLAPVTPDNPAGDDAGYDDDFQQMREEVNKLSGADAGIV
SQLAEKLLTTRTKDIRVATWYIWARLRQDGEKGLADGLELLTGLLQRFGEHLHPQRSRARKAALEWLCSA
RILDSLSLYPEVVKADTLRIAGALWLAEQTFTDEASAPVLNGLYQALENRLMKAGGVDAVVPQEAAAPAP
TVTSGSVMALSAITSGQELLSQARVLAKYLRDQPEGWLAAHRLMKSVRHDTLHQLPPLSADGRTRIAPPG
PDRRASLKRLYLQQNWLSLLEQCDDMFARGASHLWLDLQWYIHQALLQTGKENYAAIIQYDLKGLLLRLP
GLETLAFNDGMPFADDVTLSWIQQQVMECGERWAEEPSVTITAAPGDNDILSLEPEALQIADNEGTEAAL
SWLQARPGIQSDRSNWLLRLLMARVAEQTGKNDLALHLLAELDERATRLTLSQWEPELVFEVKARRLKLL
RMKSAKTESDRVRLQPDMEHLLAGLIAIDAARAAVLCNSGSS
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4873637-4875235 Escherichia coli 042, complete genome
ATGGCTTCCATTCATTCGCTCCTCAGTGCATGCCAGACGACACCCCGGGATGTGGCTGAACCGGCTCAGG
TGCGTATTGCGCTGTGGGATAAATGGCTTGCTCCCGTGACGCCAGATAATCCCGCAGGTGATGATGCGGG
GTACGATGATGATTTTCAGCAGATGCGTGAAGAGGTCAATAAACTCTCCGGAGCCGATGCCGGAATTGTC
AGCCAGCTTGCAGAAAAATTACTGACCACCAGAACCAAAGATATCCGGGTGGCGACCTGGTATATCTGGG
CCCGTCTGCGGCAGGATGGTGAAAAAGGTCTGGCCGACGGTCTGGAGCTGCTGACCGGTTTGTTGCAGCG
TTTTGGAGAGCACCTGCATCCACAACGGTCACGGGCCAGGAAGGCGGCGCTGGAGTGGTTATGCAGCGCC
CGCATACTGGACAGTCTGTCTCTGTATCCGGAGGTGGTGAAGGCGGATACCCTGCGCATTGCCGGGGCGC
TGTGGCTGGCAGAACAGACCTTTACGGATGAGGCTTCCGCCCCGGTGCTGAACGGGTTATATCAGGCACT
TGAAAATCGCCTGATGAAGGCCGGTGGTGTTGATGCAGTGGTGCCTCAGGAGGCTGCCGCGCCGGCACCG
ACGGTAACATCCGGCAGCGTCATGGCATTATCTGCCATCACCTCCGGACAGGAACTGCTGTCACAGGCCC
GTGTTCTGGCAAAATATCTGCGTGACCAGCCTGAGGGCTGGCTGGCGGCTCATCGACTGATGAAAAGCGT
CCGGCATGACACGCTGCATCAGTTACCGCCGTTATCTGCTGATGGACGGACCCGTATTGCCCCACCGGGG
CCGGACCGGCGTGCGTCACTGAAACGGTTGTATCTGCAGCAGAACTGGTTGTCACTGCTTGAACAGTGTG
ACGATATGTTTGCCCGGGGAGCCAGTCATCTGTGGCTGGACCTGCAGTGGTATATTCATCAGGCGCTGTT
GCAGACCGGAAAAGAAAATTATGCTGCCATTATTCAGTATGACCTGAAAGGATTGCTTCTGCGCCTGCCG
GGGCTTGAGACACTGGCTTTTAACGACGGCATGCCGTTTGCCGATGACGTGACGCTGAGCTGGATACAGC
AGCAGGTGATGGAGTGTGGTGAACGCTGGGCGGAAGAACCTTCTGTAACGATAACGGCAGCTCCCGGAGA
TAACGACATTTTATCTCTTGAGCCGGAAGCCCTGCAGATTGCGGATAATGAAGGAACAGAAGCCGCTTTA
AGCTGGTTACAGGCACGTCCCGGTATTCAGTCTGACCGCAGCAACTGGCTACTGCGCCTGTTGATGGCCC
GTGTTGCCGAACAGACAGGAAAAAATGACCTTGCCCTGCACCTGCTTGCGGAGCTGGATGAACGTGCAAC
CCGGCTGACCCTGTCACAATGGGAACCTGAACTGGTATTTGAGGTAAAAGCCCGCCGCCTGAAACTGTTG
CGTATGAAGTCCGCAAAAACTGAAAGTGACAGGGTGCGTCTGCAGCCTGATATGGAACATCTTCTTGCCG
GGCTCATCGCCATTGATGCTGCCAGAGCTGCTGTGTTGTGCAATTCGGGAAGTTCATGA