SecReT6
Protein ID: 387609963
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4542
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4875937..4877700 [+]
Productputative type VI secretion protein
NoteTssF
UniProt IDD3GUX3
KEGG IDelo:EC042_4542
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-179, Aligned region: 6..581
Protein Sequence: 587 a.a.     [Download]
>gi|387609963|ref|YP_006098819.1| putative type VI secretion protein [Escherichia coli 042]
MDDLTLRYFDAEMRYLREAGKAFAQAHPDRAAMLDLDKAGTPDPCVERLFEGFAFSMGRLRQKIDDDLPE
LTESLVSMLWPHYLRTIPSLSVVALTPRLSVMKMAETVPAGLEVTSRPVGPGNTVCRYRTTRAIPLNPLA
VEKVVMTTEPDGRSVLKIGFACSELADWSQVDLHRLSLYLAAEAPVSSTLHLMMTKRLAALYLRLPGNDE
RIRIDGWFSPGGFAEEDRLWPKGDSAFSGYQLLLEYFTFREKFMFVHLNGLENVSLPAGISGFDLEVVLS
QPWPADLPVTDDALCLHCVPVINLFTLEADPLIINGLESEYLLRPKRLQDGYTEIYSVDAVTGSGRTGSA
EYVPFTSFRHRGGMLRHDAPERYYHTRVKRGVTGMYDTWLILGGQRWEADRMPERETLSLRITGTNGQLP
RRALQSTLLDRCEQVLQAPVSVRNLCKPTLPVYPPTEDRFHWRVMSHLGTGFLNMLSSAEVLRGTLALYN
WRDDELNHRRLDAILAVQHHRIQRFEKGFLLRGLDVEVTLDGNGFAGEGDIHLFGEMLNRFLALYADMNQ
FNQLTLIVQPEGKCIRWKENHNPRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4875937-4877700 Escherichia coli 042, complete genome
ATGGACGATTTAACCCTGCGTTATTTTGACGCTGAAATGCGTTATCTGCGTGAAGCCGGAAAGGCGTTTG
CACAGGCTCATCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCGGGTACGCCTGATCCCTGCGTGGA
ACGCCTGTTTGAAGGTTTCGCCTTTTCCATGGGACGACTGCGCCAGAAAATCGACGATGATTTGCCGGAG
CTTACTGAAAGTCTGGTCAGTATGCTCTGGCCTCATTACCTGCGTACTATCCCGTCCCTGTCGGTGGTGG
CACTGACTCCCCGGTTATCCGTCATGAAAATGGCTGAAACCGTACCAGCCGGACTGGAAGTGACTTCCCG
CCCTGTTGGCCCCGGAAATACAGTCTGTCGTTACCGTACCACCCGGGCCATACCACTGAATCCACTGGCA
GTGGAGAAGGTTGTTATGACGACGGAGCCGGACGGGCGTTCAGTGTTGAAAATAGGTTTTGCCTGCAGTG
AACTGGCTGACTGGTCTCAGGTCGATTTGCATCGTCTGAGCCTGTATCTGGCAGCAGAAGCCCCGGTCAG
CAGCACCCTTCATCTGATGATGACAAAGCGTCTGGCTGCGCTGTATCTGAGGCTGCCGGGAAATGATGAG
CGGATCCGCATTGACGGATGGTTTTCACCCGGTGGTTTTGCAGAAGAAGATCGGCTGTGGCCGAAAGGTG
ACAGTGCTTTCAGTGGGTATCAGTTATTGCTGGAATATTTCACCTTTCGGGAAAAGTTTATGTTTGTTCA
TCTGAACGGACTGGAGAATGTTTCTCTGCCGGCAGGTATTTCCGGATTCGATCTTGAGGTGGTGCTGAGT
CAGCCCTGGCCAGCAGATTTACCTGTGACAGACGATGCCCTGTGTCTGCATTGTGTGCCGGTGATTAACC
TTTTTACGCTTGAAGCCGATCCACTCATCATCAATGGGCTGGAGAGCGAATACCTGCTGCGCCCGAAGCG
TCTGCAGGATGGGTATACGGAGATATATTCAGTGGATGCGGTGACGGGCTCCGGGCGGACCGGCAGTGCA
GAGTACGTGCCTTTTACCAGCTTCCGTCACCGTGGGGGAATGCTGCGCCATGATGCACCCGAACGTTATT
ATCATACCCGGGTGAAGCGGGGTGTCACGGGGATGTATGACACATGGCTTATCCTTGGCGGTCAGCGGTG
GGAGGCGGATCGGATGCCGGAGCGGGAAACGCTTTCATTACGTATTACAGGTACCAATGGTCAGCTTCCC
CGTCGTGCGTTGCAGAGTACGCTGCTTGATCGGTGTGAACAGGTACTGCAGGCCCCGGTCAGTGTACGTA
ATCTTTGTAAACCCACGCTACCGGTTTATCCGCCGACAGAAGATCGTTTTCACTGGCGGGTGATGAGTCA
TCTGGGGACAGGATTTCTTAACATGCTGAGCAGTGCGGAAGTGCTGCGTGGCACGCTGGCGCTTTATAAC
TGGCGGGACGATGAACTTAATCACCGTCGGCTTGATGCCATTCTGGCTGTACAGCATCATCGTATTCAGC
GTTTTGAAAAGGGTTTTCTGCTCCGGGGGCTTGATGTGGAGGTAACTCTTGATGGCAACGGGTTTGCCGG
AGAGGGAGATATTCACCTGTTTGGCGAAATGCTCAACCGTTTCCTGGCCCTGTACGCCGATATGAATCAG
TTCAATCAGCTCACACTGATTGTTCAGCCTGAAGGAAAATGCATCCGGTGGAAAGAAAATCACAATCCGC
GCCTGCCCGGTTAA