SecReT6
Protein ID: 387609964
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4543
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4877754..4878755 [+]
Productputative type VI secretion protein
NoteTssG
UniProt IDD3GUX4
KEGG IDelo:EC042_4543
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.70E-74, Aligned region: 1..293
Protein Sequence: 333 a.a.     [Download]
>gi|387609964|ref|YP_006098820.1| putative type VI secretion protein [Escherichia coli 042]
MLEQSQPDQPPIGSGWQARQEAVRFCPYPGMGFPASEIKDAVIPEESHLPPIVHVTFMGLYGVTSPLPAH
YISDIAQQREGHEAAADFLDIFSHRLITQYYRIWRKYSYPATFEAGGQDKTSQYLLGLARLGIPGCAQNI
ATPVSRFLALLPLMLLPGRTAEGLTSLVTLLAPGTQARVWHHDRRRIPLKTPLTMRVHHPVSLKSRPVMG
DHATDVNGQVLLQLSTQTGSEVQGWLPGGHLYSDLLALLHVYLGSRLDVRLQLCVERSLLPDARLSCRPA
AGSPQLGRTAVMRTQAKIATSAARVMTISLGRYQRVQEHYQRKETQENGDYRW
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4877754-4878755 Escherichia coli 042, complete genome
TTGCTGGAACAAAGCCAGCCAGACCAGCCTCCCATTGGCAGTGGCTGGCAGGCCCGTCAGGAAGCGGTTC
GCTTTTGTCCATACCCGGGAATGGGGTTTCCTGCGAGTGAAATAAAAGACGCTGTAATTCCTGAAGAATC
CCATCTGCCACCCATTGTACATGTGACGTTTATGGGACTTTACGGGGTCACGTCTCCGTTGCCGGCACAC
TATATCAGTGATATTGCACAGCAGCGGGAAGGCCATGAGGCCGCAGCGGATTTTCTCGATATATTCAGTC
ATCGTCTGATCACCCAGTATTACCGTATCTGGCGTAAATATTCGTACCCGGCCACCTTTGAGGCGGGAGG
ACAGGATAAAACATCCCAGTATCTGCTCGGTCTGGCCAGACTGGGGATCCCCGGATGTGCACAGAATATT
GCCACGCCGGTATCGCGTTTTCTGGCGTTATTGCCCCTGATGTTGTTACCCGGAAGAACAGCTGAAGGGC
TGACATCACTGGTAACGCTGCTGGCTCCCGGAACACAGGCCCGTGTCTGGCATCATGACCGACGACGGAT
CCCGCTGAAAACACCGCTGACCATGCGTGTTCATCACCCGGTCAGTCTGAAGAGTCGCCCGGTGATGGGC
GATCATGCCACGGATGTGAACGGACAGGTGTTATTACAGCTTTCAACACAGACGGGCAGCGAGGTACAGG
GCTGGTTACCAGGCGGGCATCTGTATTCTGATTTGTTGGCGTTGTTGCATGTTTATCTGGGAAGCCGTCT
GGATGTACGTCTGCAACTTTGTGTTGAGCGTTCACTGTTACCGGATGCCCGGCTCAGTTGCCGACCGGCA
GCCGGTAGTCCGCAACTGGGGCGCACGGCAGTAATGAGAACACAGGCAAAGATAGCGACTTCAGCGGCAC
GCGTCATGACCATCAGTCTGGGGCGTTATCAGCGGGTTCAGGAACATTATCAACGTAAGGAGACTCAGGA
AAATGGCGATTATCGCTGGTAA