SecReT6
Protein ID: 387609965
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4544
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4878736..4879272 [+]
Productputative type VI secretion protein
NoteTssJ
UniProt IDD3GUX5
KEGG IDelo:EC042_4544
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.20E-37, Aligned region: 19..169
Protein Sequence: 178 a.a.     [Download]
>gi|387609965|ref|YP_006098821.1| putative type VI secretion protein [Escherichia coli 042]
MAIIAGKAGYGLIIALFSLSLSGCGLTQRVADGTVSATKSLFYRQIKTLHLDIRAREAINTSAAGIPLSV
VVRIYQLKDNRSFDSADYQALFTGDNEILAGDIIAQKDVWLQPGGSVAVDMPLDDAAKFTGVAAMFLEPD
QKKNTWRVVLGRDELEPDTPRLIEVSGNTLTLLPVKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4878736-4879272 Escherichia coli 042, complete genome
ATGGCGATTATCGCTGGTAAGGCTGGTTACGGTCTGATTATTGCGTTGTTTTCCCTGTCGTTATCAGGAT
GCGGTCTGACGCAAAGAGTGGCAGACGGTACGGTATCTGCCACGAAATCCCTGTTTTACCGACAGATAAA
AACACTTCACCTGGATATTCGTGCCAGGGAGGCCATTAACACCAGTGCTGCCGGTATTCCCCTGTCGGTT
GTGGTGCGGATTTATCAGCTTAAAGACAACCGGAGTTTTGACAGTGCGGATTATCAGGCGCTTTTTACAG
GGGACAATGAAATTCTGGCAGGCGATATCATTGCACAGAAAGATGTATGGCTGCAGCCAGGTGGTTCAGT
AGCCGTGGATATGCCTCTGGATGATGCGGCGAAATTTACCGGTGTGGCAGCAATGTTTCTGGAGCCTGAC
CAGAAGAAAAATACCTGGCGGGTGGTGCTGGGCCGGGATGAGCTTGAGCCGGACACGCCCCGTCTTATTG
AAGTATCCGGTAACACCCTGACCCTGTTACCGGTGAAGGATAAATAG