SecReT6
Protein ID: 387609966
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4545
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4879275..4879706 [+]
Productputative type VI secretion protein
NoteTssE
UniProt IDD3GUX6
KEGG IDelo:EC042_4545
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.50E-19, Aligned region: 26..114
Protein Sequence: 143 a.a.     [Download]
>gi|387609966|ref|YP_006098822.1| putative type VI secretion protein [Escherichia coli 042]
MPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGTA
HQLMRVLSDVLLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQRY
VQT
 
Nucleotide Sequence: 432 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4879275-4879706 Escherichia coli 042, complete genome
ATGCCGCGTCCTTCCCTTTATGAAATTCTCTATGGCAATTTCACTGGCGGGCTGGAGTTAAACCAGGTCG
GTGAGGAAGAGCAGGTTATTCTTTCGGTGCTCGATAACATGCAGCGTATTCTGAATACCCGTGCCGGAAG
CCTTAAGCATCTTCCGGATTATGGTCTGCCGGATATAACAACCATTCTGCAGGGAATGCCGGGGACGGCG
CATCAACTGATGCGCGTGCTTTCAGACGTTCTGCTGAAGTATGAGCCACGTATTAAGCGCGTCGACGTGA
CGATGCAGGAACAGACTCAGCCTGGTGAGTTGCATTATGTCATTGATGCAGAACTTAAAGATGCCGGGCT
GGTTCGTTACGGAACAACATTTATACCGGAGGGCAGGGTGTTGTTGCGCCATCTGAAACAGCAGCGCTAC
GTGCAGACGTGA