SecReT6
Protein ID: 387609978
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4562
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4893076..4893552 [+]
Productputative type VI secretion protein
NoteTssB
UniProt IDD3GUY9
KEGG IDelo:EC042_4562
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-45, Aligned region: 8..146
Protein Sequence: 158 a.a.     [Download]
>gi|387609978|ref|YP_006098834.1| putative type VI secretion protein [Escherichia coli 042]
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASM
SPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKL
QELLVTTNGNPENDESKE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4893076-4893552 Escherichia coli 042, complete genome
ATGAGCAATACACAACATAAACTTGATAAAACCCGCCCCCCACGAGTACAGATAACGTATGATGTTGAAA
CCGGAGATGCTGAAACTGCGAAAGAGTTACCCCTTGTCATCGGGGTTTTGGGTGAGTACTCTTCGTCAGA
AAAACCATTGAGAGAACGAAAATTCATTAGTATAGATAAAGACAATTTTGATGAAGTTATGGCATCAATG
AGTCCGACTGCTCATTTTATGGTGGACAGTGTTATCCCGGGAAATGAAGGAAAACTGGATGTCGAACTGA
GGTTTAGTTGCAAAGATGATTTTTCTCCCGATAATGTGATTCAACAGGTTGAGTGTCTAAGAAAATTATC
GGAATTGAGGTTGCATCTTTGTGACCTACGAAACAGGGCTGCAAGTAATGAGAAACTGAAAGAAAAACTT
CAGGAATTGCTGGTGACTACTAATGGCAATCCTGAAAACGATGAAAGTAAGGAATAA