SecReT6
Protein ID: 387609979
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4563
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4893555..4895033 [+]
Productputative type VI secretion protein
NoteTssC
UniProt IDD3GUZ0
KEGG IDelo:EC042_4563
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-177, Aligned region: 65..488
Protein Sequence: 492 a.a.     [Download]
>gi|387609979|ref|YP_006098835.1| putative type VI secretion protein [Escherichia coli 042]
MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIA
DIDKLMSEQLSLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFK
NIYESEYGTFGGTPYSAFVGDFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRD
LAKLFETTDYARWRSFRQTDDSRYVGLTLPQSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAF
ELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHTGERLLQCPTEVAISDRREKELSDLGFIPLV
YCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYLKVIVRDKVGSFMSRTECQTY
LQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMSLRLVADLPSS
VS
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4893555-4895033 Escherichia coli 042, complete genome
ATGACAGTTGCATCAACATTAGGGCTGAATGAAACTCAGTATGCTACAGATGATTGTCTTGAAGAGATTA
TAAATAATACCAGAGCTGTGAGACAGGATTCTGAAAAGACCAGGTTTAAACTACAGATTAATAATTTCCT
TGCTGAAGTTGCCAGTGGTTCTTTGGTCATTAACAGCGATTTAATCGGTAGTATTGAAAAGCGGATTGCT
GATATTGATAAGTTGATGTCTGAGCAGCTTAGTCTGATTATGCATGCGACTGAATTTCAAAAAATAGAAT
CAGCATGGACGGGACTTTATAAGCTGGTTCAGGCCAGCGTTACTGAAAATGTAAAATACACGGTGTTACA
CTGTACTAAAAAGGAATTGCTCAAAGACTTCAAGTCAGCCTCAGATTTCGATCAGTCTGTCTTATTTAAG
AATATTTATGAAAGCGAGTATGGAACGTTCGGGGGAACACCGTATTCTGCTTTTGTTGGTGATTTCTATT
TTGATAATACACCGCAGGATATTGATTTGCTGGAGCATATTTCCCATGTTGCTGCCAGTGCTCATGCCCC
GTTTCTGAGTGCTATTGCTCCGGGTATGTTGTCCATGAGTTCATTTAGCGAATTACCCTACCCGCGTGAT
CTGGCAAAATTGTTTGAGACAACAGATTATGCCCGTTGGCGTAGTTTCAGGCAGACAGATGACAGTCGTT
ATGTGGGATTGACTTTGCCACAGTCTCTGGGGCGTATTCCATATGGCATGAAGACTATACCTGCCGAAAC
GTTTAATTTTGAAGAGCACATTAGTGAAGATAACTCAGGCAAAGACTATCTGTGGGTAAATACAGCTTTT
GAACTTGCCTGCCGGATAGTTGATGCTTTTGAGGAGTATGGCTGGTGTGCAGCAATTCGGGGCGTGGAAG
GTGGCGGTTTGGTTAAATCATTGCCGGCCTATAATTATGTATCCCATACAGGTGAGCGACTTTTACAATG
TCCGACGGAGGTTGCTATCTCAGACCGTCGGGAAAAAGAATTGTCAGATCTCGGTTTTATTCCTCTGGTT
TATTGTAAAGGTACTGATTTTGCGGCATTTTTCGCTGTTCAGTCGGTAAACAAAGCACGACTGTATAATA
CTGATCAGGCTAATGCGAATGCAAAATTATCCAGTCAGCTTCAGTATATATTAGCAACATCACGATTCGC
ACATTATCTTAAAGTGATTGTTCGTGACAAAGTTGGAAGCTTTATGTCGAGGACAGAATGTCAGACATAT
CTGCAAAACTGGATCATGCAATATGTTGTGGCATCAGATAACGCTGGTCAGGAGACAAAGGCTCGTTATC
CATTACGTGAGGCATCTGTTGAAGTTATTGAAGTCCCTGGAAGTCCGGGAAATTATCGTGCAATTGCATG
GATTAAACCTCATTTTCAGCTTGAGGGTTTAAGTATGTCATTGCGTCTTGTTGCTGATTTACCATCAAGT
GTAAGTTAA