SecReT6
Protein ID: 387609980
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4564
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4895043..4895549 [+]
Productputative type VI secretion protein
NoteAaiC (e)
UniProt IDD3GUZ1
KEGG IDelo:EC042_4564
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 168 a.a.     [Download]
>gi|387609980|ref|YP_006098836.1| putative type VI secretion protein [Escherichia coli 042]
MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHI
QDLLENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSI
EMNIPSDDGKSTEKLGPMTYNLYKEALV
 
Nucleotide Sequence: 507 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4895043-4895549 Escherichia coli 042, complete genome
ATGGTCGGAGTTATGAGTAATTCTTCTGCTCTTAGCAGGGAGTTTGTCAAAATAGAGATAGGTGGAAAAG
TTATAAAGGGAAATTCAAAAGTTGAAAACAGTGGTGACTACTTTGATGGACATTGTCCTCAGGCATTTCA
CGCTTTTTCAGGAATTGACGGTACTGTTTTTGATTTAATTAATTTGAAGCTTAGGGTTACTAAACACATA
CAAGACCTTCTGGAGAACTTTTTTAAGAGAGGTGAAAAAGAAGTTAAAATAGAAATTTTACGTAGGGAAT
CAACTAAATCAGGTAGTGCATACTCATCATTTAAGGTTGTTTATCAGGGGTGTCGTATGCATAATATGTT
GTTGGCTCATGATAATGATTCAAATCTCATTCTGGAATTGTCGTTTACCCCAGAAGAGAGTGTCTCAATT
GAGATGAATATTCCGTCAGATGATGGAAAAAGTACGGAGAAATTGGGACCAATGACGTACAACTTATATA
AAGAGGCTCTTGTATAA