SecReT6
Protein ID: 387609981
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4565
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4895559..4895981 [+]
Productputative type VI secretion protein
NoteTssE
UniProt IDD3GUZ2
KEGG IDelo:EC042_4565
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-06, Aligned region: 26..118
Protein Sequence: 140 a.a.     [Download]
>gi|387609981|ref|YP_006098837.1| putative type VI secretion protein [Escherichia coli 042]
MHSFLQFLRDDNPGSLEDHLNFVPSDDLKYELGMLLSSRPLYLETDELPFVSSSVLNYGIKSSVFVVSAG
EHSDSVNDEISSRILMMLQRYESRLEEPVVEYLSSDDNYSFFSVTALFFMDMVRLCIKWDKNSGEFSLDE
 
Nucleotide Sequence: 423 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4895559-4895981 Escherichia coli 042, complete genome
ATGCATTCGTTTCTTCAGTTCTTACGTGATGATAATCCGGGCTCTCTGGAAGATCATCTGAATTTTGTTC
CTTCAGATGATCTGAAATATGAGCTCGGGATGTTATTATCATCACGACCTTTATACCTTGAAACAGATGA
GCTGCCGTTTGTTAGTAGTTCTGTCCTGAACTATGGCATAAAGTCATCAGTATTTGTAGTTTCTGCAGGT
GAACATAGTGATTCTGTTAATGATGAAATTTCTTCAAGAATATTGATGATGCTCCAGCGTTATGAGTCCC
GGCTGGAGGAACCAGTTGTTGAATATCTTTCCAGTGATGATAATTATTCTTTCTTTTCAGTTACAGCCCT
GTTCTTTATGGACATGGTAAGACTCTGTATTAAATGGGATAAGAACTCAGGAGAATTTTCACTGGATGAA
TAA