SecReT6
Protein ID: 387609982
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4566
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4895974..4897776 [+]
Productputative type VI secretion protein
NoteTssF
UniProt IDD3GUZ3
KEGG IDelo:EC042_4566
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.00E-138, Aligned region: 4..597
Protein Sequence: 600 a.a.     [Download]
>gi|387609982|ref|YP_006098838.1| putative type VI secretion protein [Escherichia coli 042]
MNKLLSYYQKELAFLRKQGIEFAKKYPKVARRLGYNQGGSEDPHVQRLTESFAFLSSKIHQRLDEDLPEL
MEALLRNLAPQFLYNYPSSCIVSFEPDRKSSGITSTYRVPSGTSLYSRYKYKTICQFRTVYPLTIVPATV
NKARIHYDNSSSLWKIELNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDI
SANISGAGFYESEVTLPQKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEK
YEPDRIERNVSERLFKVNCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIWDINKVTLHRYEND
IVKQFPLKNLFGLEHSVIKQSCNIFWHSSCYRSSSERGNFEESVYIRLSDDGGAQSCIMTGDVLSIDAIC
TNGNIPSSINNGDPDGDFDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMK
LREMLSIYNYNNNHSISIFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFL
DHFLGLHAPVNSFTRMITVIEHEEHTRRVWPIRAGKLTWL
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4895974-4897776 Escherichia coli 042, complete genome
ATGAATAAACTATTATCTTACTATCAGAAAGAACTCGCTTTTCTTAGAAAACAAGGTATTGAGTTTGCAA
AAAAATATCCAAAGGTAGCCCGGCGTCTTGGATACAATCAGGGGGGGTCTGAAGATCCACATGTTCAGAG
ATTAACGGAGTCTTTTGCTTTCTTAAGTTCAAAAATTCATCAGAGATTAGATGAAGATTTACCCGAGTTA
ATGGAAGCATTACTTCGTAATCTTGCTCCCCAATTTTTGTATAACTATCCTTCATCATGTATTGTATCAT
TTGAACCAGACAGAAAATCCAGTGGAATAACTTCAACTTATAGAGTTCCTTCTGGCACATCGCTATATTC
CAGATATAAATATAAAACCATCTGTCAGTTTCGGACGGTATATCCACTGACTATTGTCCCTGCAACGGTT
AATAAAGCAAGAATTCACTATGATAATTCGTCCTCCTTATGGAAAATTGAATTGAATTTAGACGTTTTCG
ACGGAGCTAATTTTTCTCTTGATTTTGTAAGATTTTATTTGAATGGTCCGGCAACGGTTACTGGTATAAT
ATATACATTATTGTGCGATGAGGTCGATAATATCGTTTTGCAGAGAAATAATGATGTGTTATATGATATC
AGTGCTAATATATCCGGTGCCGGATTTTATGAGAGTGAAGTAACACTTCCACAAAAAGGGAACGTTTCTT
ATATACATAACCTCATACTGGACTATTTTTCTTTTCCAGAACGATTTAACTTCATTGATATAGAATTTGA
CTCCGGAATCGAATTATGCTCAGGGGATTCTGTGAGAATAGAAATAACATTAAAAAGCAGTGCAGAAAAG
TATGAGCCAGACAGAATAGAAAGGAATGTTTCTGAAAGACTTTTTAAAGTAAACTGTTCTCCCGTTGTCA
ATCTCTTCGAGAAGAAAACTGAACCCCTACGATTATCTGATGGCCAGGATGAGTATCAGGTAAATACCGA
TTTATATTCACGTAATGAAGTCTTAATCTGGGATATAAATAAAGTGACATTGCACAGATATGAAAATGAT
ATAGTCAAGCAGTTTCCGTTAAAAAATTTATTTGGACTTGAACATTCTGTCATTAAACAATCGTGCAATA
TATTCTGGCATAGTTCATGTTATCGCTCGTCTTCTGAAAGAGGGAACTTTGAGGAAAGTGTATATATTCG
TCTGAGCGATGATGGCGGAGCCCAGTCATGTATCATGACTGGGGATGTCCTTTCAATTGATGCAATATGT
ACAAATGGTAATATTCCATCATCAATTAATAATGGTGATCCTGATGGTGATTTTGATTGTGATATAGATA
TTGCTCAGCTGCGAATAACTGCGCTGAACCGTCCATCAAGAATGTTGCCGGCTATGGCATTAAAAGGAAT
GAACTGGAGAATTGTTTCTCAGTTATCCCTTAATTTTGTGTTGCTCAGTGGTACTGATGGGGCAATGAAA
CTGAGAGAAATGCTATCCATATATAACTACAACAATAACCACTCAATATCAATTTTTATTGAATGGATTA
AAGAGTTACAAATCACACCAGTTTCATCCCGTTTACCCGGCATATATCCGCCTGTAACTGCTCGTGGAAT
TGATATTACCGTAACTCTTTCAAAGGATGCAGATATGCACCCTGAATGTTTCATGTTTTGCTCTTTCCTT
GATCACTTTCTTGGGCTACATGCCCCTGTCAATAGCTTTACTCGCATGATTACTGTCATTGAACATGAGG
AGCACACTCGTCGTGTATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTTGA